Details for Arabidopsis Locus AT3G14080

Position : Chr3 ( 5`- 4667365 .. 4669194 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14080

Protein [Map View]
MSWAGPEEIYLSTSLASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACERVIVGEQYCDIPLGLYVIRGENVVLIG
ELDTEREELPPHMIRVSEAEIKRAQKVEREASELRGTMRKRMEFLDFD*

DNA
ATGTCGTGGGCTGGTCCTGAAGAAATTTATCTTTCAACATCACTCGCTAGTTATCTCGATAGAAAACTACTTGTGCTTCT
TAGAGATGGTAGAAAGCTAATGGGAACACTCCGTTCCTTTGATCAATTCGCCAATGCGGTTCTAGAAGGTGCGTGTGAGA
GGGTAATTGTTGGTGAACAATACTGTGACATTCCTTTAGGCCTCTATGTAATCCGTGGAGAGAATGTTGTTTTGATTGGT
GAGCTGGACACGGAGAGAGAAGAGCTTCCTCCACATATGATTCGCGTCTCAGAGGCAGAGATTAAAAGGGCACAAAAGGT
GGAGAGGGAAGCGAGTGAGCTGAGAGGAACAATGAGGAAGAGAATGGAGTTTCTTGACTTTGATTAA