Details for Arabidopsis Locus AT3G14075

Position : Chr3 ( 5`- 4663569 .. 4667079 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14075

Protein [Map View]
MATATMATAAGAAALLYYTLNRKLIAGPSDVDDENSEASASRPSLRIDRVSHRLIQAPATWLETISTLSETLRFTYSETL
GKWPIGDLAFGINFLIKRQGLLHVDRVFGGKDSVELRGSEVATELKYLLHLLTLCWHFSKKSFPFFLEETGFTKENVLIH
EPKAGILKPAFTVLVDHNTKYFLLLIRGTHSIKDTLTAATGAIVPFHHTVVNERGVSNLVLGYAHCGMVAAARCIAKLAT
PCLLKGLEQYPDYKIKIVGHSLGGGTAALLTYIMREQKMLSTATCVTFAPAACMTWELADSGNDFIVSVINGADLVPTFS
AAAVDDLRAEVTASAWLNDLRNQIEHTRILSTVYRSATALGSRLPSMATAKAKVAGAGAMLRPVSSGTQVVMRRAQSMLT
RPALSISSWSCMGPRRRASATQSISEHQLDTSEAMSQDIPETSDPLLVTDEEITGKWKSEAECSNYEETSPRLGATDLDE
CEDPAEMDTREERMTEAELWQQLEHDLYHDSSEQPEETDVAKEIKEEEEAVIAEAGVAPPESQTAEMKESRRFLPAGKIM
HIVTVRPEAVEPNEEEDEDGSALERPETVETVEEGRVGIFLTPRSLYSKVRLSQRMISDHFMPVYRRQIERLIQELTVEQ
HP*

DNA
ATGGCAACTGCAACTATGGCAACAGCAGCTGGAGCAGCTGCTCTTTTATATTACACGTTGAATCGGAAATTAATAGCTGG
TCCATCTGACGTTGACGATGAGAATTCTGAAGCTTCTGCTTCTCGTCCTTCTTTGAGGATTGACCGTGTTTCGCATAGGC
TTATTCAAGCTCCGGCAACTTGGTTGGAGACTATTTCTACTCTTTCTGAGACTCTTCGTTTTACTTACTCTGAGACTCTT
GGGAAGTGGCCTATTGGTGATCTTGCGTTTGGGATCAATTTTCTCATCAAGAGGCAGGGACTTCTACATGTTGATCGTGT
CTTTGGTGGTAAAGATAGTGTAGAACTTAGAGGATCAGAAGTAGCCACTGAACTCAAATATCTTTTGCACTTGTTGACAT
TGTGTTGGCATTTTTCCAAGAAGTCGTTTCCGTTTTTCTTAGAAGAGACCGGCTTTACAAAGGAAAATGTCCTTATTCAT
GAACCCAAAGCTGGGATATTGAAGCCAGCTTTTACGGTTCTTGTCGATCACAATACAAAATATTTTCTGTTATTGATTCG
TGGAACGCATAGCATCAAAGATACCTTGACTGCTGCAACTGGAGCAATCGTACCGTTCCATCATACTGTTGTAAATGAAA
GAGGGGTCAGCAATTTGGTCTTAGGTTATGCTCATTGTGGTATGGTTGCTGCTGCCCGGTGTATAGCTAAACTTGCCACC
CCTTGTCTTCTCAAGGGTCTTGAGCAATATCCAGATTACAAAATCAAGATCGTAGGGCACTCTTTGGGTGGTGGAACGGC
TGCACTTTTAACATATATTATGCGGGAGCAGAAAATGCTCTCTACAGCTACATGTGTTACATTTGCGCCAGCTGCTTGTA
TGACTTGGGAATTAGCCGACTCTGGGAATGACTTCATCGTATCTGTCATAAACGGAGCTGATCTGGTGCCTACATTTTCT
GCTGCAGCTGTAGATGACTTACGTGCTGAGGTAACAGCATCTGCTTGGCTAAATGATCTGAGAAATCAAATCGAACACAC
CCGAATCCTCAGCACTGTTTATCGCTCAGCGACGGCTTTAGGATCACGACTTCCATCGATGGCCACTGCCAAAGCAAAAG
TTGCTGGCGCTGGTGCAATGTTACGCCCGGTTTCTAGTGGCACACAGGTTGTGATGAGAAGAGCTCAAAGCATGCTGACC
CGTCCTGCACTAAGCATATCTTCTTGGTCATGTATGGGACCCCGGCGCAGAGCCTCTGCTACTCAGTCAATCTCGGAACA
TCAGTTAGATACTTCTGAAGCAATGTCCCAAGATATACCCGAAACTTCGGATCCTCTTCTTGTTACGGATGAAGAAATCA
CCGGGAAATGGAAATCAGAAGCCGAGTGTTCTAATTACGAGGAAACATCACCTCGTCTTGGAGCCACTGATCTTGACGAG
TGTGAGGATCCAGCGGAAATGGACACACGGGAAGAGCGGATGACTGAAGCTGAGCTATGGCAGCAACTGGAGCATGACCT
TTACCACGATTCTTCGGAGCAACCTGAAGAAACCGATGTGGCAAAAGAAATAAAAGAAGAAGAAGAAGCCGTCATTGCAG
AGGCCGGTGTGGCCCCGCCGGAGAGCCAGACGGCCGAGATGAAAGAATCCCGCAGATTCCTCCCAGCGGGTAAAATCATG
CATATTGTCACGGTGCGGCCCGAGGCCGTAGAGCCTAACGAAGAAGAAGACGAAGATGGTTCTGCCCTCGAGAGGCCTGA
GACAGTGGAGACGGTGGAGGAGGGTAGAGTAGGAATATTTCTGACGCCGAGGTCATTGTATAGTAAGGTGAGGTTATCGC
AGAGGATGATAAGCGATCATTTCATGCCTGTTTACAGGCGACAGATCGAACGGCTAATACAAGAGCTAACAGTGGAACAA
CATCCTTGA