Details for Arabidopsis Locus AT3G14070

Position : Chr3 ( 5`- 4661143 .. 4663074 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14070

Protein [Map View]
MSAVSFLYSSKTPKFRGVFNGICALVLFCFFFDRSELLRNPLLRNASFVNGGSGSTSGGITQFMVIRRNARQIETNGSGN
NSSLSSSSTVLCSGLHKHMGYADQCEFLKANPICSPDGFFDYLSFFYCSCRDFSILGYMMLGVWLVALFYLLGNTAADYF
CCSLEKLSKLLRLPPTVAGVTLLPLGNGAPDVFASIAAFVGTDKGEVGLNSVLGGAVFVTSVVVGIVSLCVADKEVKIDK
NCFIRDLSFFLFSLVSLLVILMVGRVTVRIAIAFVSIYVVYAFLVAANVILRKHAKRFKLEALTPLLPMQGSVFSPSVGE
DMPMNTPLIETETEDGPPRLQSLPQWMWASNVAIYSNHFAKVSVHDEDRPPWGWIDDTAEVESSSCTKFTSLLEIPLTIP
RRLTIPSVEEDTWSKTYAVASVSLAPVLLASLWSSQDDVSLQACGVAYFFSVVIGSTLGFLAYKNTEPDHPPRRFLIPWV
LGGFIMSIVWFYMIANELVALLVTFGEIYGINPSILALTVLAWGNSMGDLVSNIALTMNGGDGVQIALSGCYAGPMFNTL
VGLGMSMLFGAWSKSPDTYMLPEDKSLFYTLGFLVLGLVWAMVILPRNDMQPSRTLGVGLIAIYLIFVTFRLSCAMGFIP
WAA*

DNA
ATGAGCGCGGTTAGTTTTCTTTACAGCTCGAAAACCCCCAAATTTCGAGGGGTTTTCAATGGGATTTGTGCTCTGGTTCT
GTTTTGCTTCTTCTTTGATCGGAGCGAATTACTCAGAAACCCTTTGTTAAGGAACGCGTCTTTCGTCAATGGTGGTAGTG
GCTCAACCTCCGGAGGTATCACCCAGTTTATGGTAATTCGTAGAAATGCGAGGCAAATTGAAACGAATGGTTCTGGTAAT
AATAGCAGCTTGAGTAGCAGTAGTACTGTTTTATGCTCAGGGTTACACAAACACATGGGTTATGCTGATCAATGCGAGTT
CTTAAAAGCAAACCCAATTTGTTCCCCTGATGGATTCTTTGATTACCTCAGCTTCTTTTACTGCTCCTGTAGAGATTTCA
GTATCTTGGGTTACATGATGTTAGGTGTTTGGCTTGTTGCTTTGTTTTATCTGTTGGGTAATACTGCTGCTGATTACTTT
TGTTGTTCACTGGAGAAGCTTTCAAAGCTTTTGAGGCTGCCTCCAACTGTTGCTGGTGTTACTTTACTTCCTCTTGGGAA
TGGAGCACCAGATGTGTTTGCTAGTATAGCTGCTTTTGTTGGTACAGATAAAGGAGAAGTTGGTCTTAACAGCGTCTTGG
GTGGTGCTGTGTTTGTTACTTCTGTTGTTGTAGGGATTGTTTCGCTTTGTGTTGCGGATAAGGAAGTCAAGATCGATAAG
AATTGCTTCATCAGAGACTTGAGTTTCTTCCTTTTCTCGCTTGTGTCTTTGCTGGTGATTTTGATGGTTGGTAGAGTGAC
AGTCCGGATTGCCATCGCGTTTGTCTCAATATATGTGGTTTATGCTTTCCTTGTGGCAGCGAATGTGATTCTGAGAAAAC
ATGCTAAGAGGTTTAAACTAGAGGCTCTTACTCCTTTGCTACCTATGCAAGGAAGTGTGTTTTCCCCGAGTGTTGGAGAG
GATATGCCAATGAATACCCCCTTGATAGAAACTGAGACTGAGGATGGTCCACCTCGGCTACAGAGTCTTCCTCAGTGGAT
GTGGGCGTCAAATGTGGCCATCTATTCAAACCATTTCGCAAAAGTTAGTGTACATGATGAAGACAGGCCACCTTGGGGAT
GGATTGATGACACTGCAGAAGTAGAGAGCTCCTCATGTACTAAATTCACTTCCTTGTTGGAAATTCCGCTGACCATTCCA
AGGAGATTAACAATTCCATCGGTCGAAGAAGATACATGGTCAAAGACATATGCTGTGGCCAGCGTCTCATTAGCGCCTGT
CCTTTTGGCGTCTCTCTGGAGTAGCCAAGACGATGTGAGTCTCCAAGCTTGTGGTGTCGCATACTTTTTCAGCGTTGTTA
TAGGCTCCACTCTTGGCTTTCTGGCTTACAAAAACACAGAACCTGATCACCCACCTCGAAGATTCTTGATCCCTTGGGTT
CTTGGTGGGTTTATAATGAGCATCGTATGGTTCTACATGATAGCAAACGAACTCGTTGCTCTTCTGGTGACATTTGGTGA
GATTTACGGAATCAACCCGTCGATACTTGCGCTAACAGTACTTGCTTGGGGAAACTCAATGGGTGACTTAGTATCGAATA
TCGCATTGACAATGAACGGTGGGGATGGTGTACAAATCGCTCTATCGGGATGCTACGCCGGTCCAATGTTCAACACACTC
GTCGGGCTAGGTATGTCGATGCTTTTTGGCGCATGGTCCAAGAGTCCTGACACATACATGCTACCAGAAGACAAAAGCCT
ATTCTACACACTTGGGTTTCTAGTACTCGGTTTGGTTTGGGCTATGGTGATACTCCCGCGCAACGACATGCAACCTAGCA
GAACCTTAGGTGTTGGACTCATTGCAATATATCTGATATTCGTCACTTTCAGGCTGAGCTGCGCCATGGGATTCATACCA
TGGGCTGCTTAA