Details for Arabidopsis Locus AT3G14067

Position : Chr3 ( 5`- 4658198 .. 4660784 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14067

Protein [Map View]
MAKLSLSSIFFVFPLLLCFFSPSSSSSDGLESYIVHVQRSHKPSLFSSHNNWHVSLLRSLPSSPQPATLLYSYSRAVHGF
SARLSPIQTAALRRHPSVISVIPDQAREIHTTHTPAFLGFSQNSGLWSNSNYGEDVIVGVLDTGIWPEHPSFSDSGLGPI
PSTWKGECEIGPDFPASSCNRKLIGARAFYRGYLTQRNGTKKHAAKESRSPRDTEGHGTHTASTAAGSVVANASLYQYAR
GTATGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGASGSAPEYHTDSIAIGAFGATRHGIVVSCSAG
NSGPNPETATNIAPWILTVGASTVDREFAANAITGDGKVFTGTSLYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVE
GKIVLCDRGGNARVEKGSAVKLAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTL
IGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLR
KAHPDWSPAAIKSALVTTAYDVENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPG
ILVFLQDPTLYDACETSKLRTAGDLNYPSFSVVFASTGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFS
KEKSVLEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF*

DNA
ATGGCTAAGCTCTCTCTTTCCTCCATCTTCTTCGTCTTCCCTCTCCTCCTCTGTTTCTTTTCCCCTTCTTCTTCTTCATC
GGATGGCTTAGAATCCTACATCGTCCATGTGCAGAGATCTCATAAGCCTTCCCTCTTCTCCTCCCACAACAACTGGCACG
TCTCTCTCCTTCGCTCTCTCCCTTCTTCTCCCCAACCAGCAACGCTGCTCTACTCTTATTCACGCGCCGTTCATGGCTTC
TCCGCTCGTCTCTCCCCTATCCAAACCGCCGCCCTCCGCCGTCATCCTTCAGTCATCTCCGTTATACCTGATCAAGCGCG
TGAGATCCACACAACTCACACGCCTGCCTTCCTCGGTTTCTCCCAAAACTCTGGACTCTGGAGCAACTCAAATTACGGGG
AAGACGTGATCGTCGGCGTTTTAGATACTGGAATCTGGCCGGAACATCCAAGTTTCTCGGATTCAGGTCTCGGTCCAATT
CCATCTACCTGGAAAGGCGAGTGCGAGATCGGACCTGATTTTCCTGCCTCATCTTGCAATCGGAAGCTTATCGGAGCTCG
AGCGTTTTACAGGGGATATTTAACGCAACGGAATGGAACAAAAAAGCATGCAGCCAAGGAATCGAGATCGCCGCGTGATA
CAGAAGGTCATGGCACGCACACGGCATCTACGGCAGCTGGATCGGTGGTTGCTAACGCGAGTTTGTACCAGTACGCGCGC
GGAACAGCTACTGGGATGGCGTCAAAGGCGAGAATCGCCGCTTACAAAATCTGTTGGACCGGCGGATGTTACGATTCCGA
TATCCTCGCCGCCATGGATCAGGCGGTTGCCGACGGTGTTCACGTTATCTCTCTCTCCGTCGGAGCCAGCGGTTCCGCCC
CGGAGTATCACACGGACTCTATAGCGATCGGAGCATTTGGAGCCACGCGGCACGGCATCGTCGTTTCTTGCTCCGCTGGG
AATTCTGGTCCTAATCCTGAAACCGCGACGAACATCGCTCCATGGATCTTAACCGTTGGTGCGTCCACCGTCGATAGAGA
ATTCGCCGCAAACGCAATCACGGGAGACGGGAAAGTCTTCACGGGAACATCACTGTACGCAGGCGAATCTCTACCGGATT
CTCAACTTTCTCTGGTATATTCCGGCGATTGCGGAAGCAGATTGTGTTACCCTGGGAAATTGAATTCATCATTGGTTGAA
GGCAAAATCGTGCTCTGTGACAGAGGAGGCAACGCAAGAGTTGAGAAAGGAAGTGCAGTCAAGCTAGCCGGTGGTGCTGG
TATGATTCTGGCGAACACAGCTGAAAGCGGTGAAGAATTAACCGCCGATTCGCATCTCGTCCCGGCGACAATGGTTGGAG
CTAAAGCTGGAGATCAAATCCGCGACTACATCAAAACATCAGACTCTCCCACTGCAAAAATCAGTTTCCTAGGCACTTTG
ATCGGACCATCTCCTCCTTCTCCCAGAGTCGCCGCTTTCTCCAGCCGTGGACCGAATCACTTGACACCGGTTATTCTTAA
ACCGGACGTGATTGCTCCTGGAGTCAACATTTTAGCCGGTTGGACCGGGATGGTTGGTCCTACCGATTTAGATATCGATC
CAAGACGGGTTCAATTCAACATCATCTCCGGTACATCGATGTCGTGCCCACACGTTAGTGGACTCGCCGCTCTCCTCCGT
AAAGCTCATCCCGATTGGTCACCTGCAGCAATCAAATCCGCCCTTGTAACCACCGCTTACGATGTCGAAAACTCCGGCGA
ACCAATCGAGGATCTCGCCACCGGTAAATCATCGAACTCATTCATCCACGGAGCTGGACACGTCGATCCAAACAAAGCTT
TGAATCCTGGTTTGGTTTACGACATCGAGGTCAAAGAGTACGTAGCTTTCCTCTGCGCCGTGGGATACGAGTTTCCGGGG
ATTCTAGTCTTTCTTCAAGATCCAACTCTTTACGACGCATGTGAAACGAGCAAGCTAAGAACCGCCGGCGATCTCAATTA
CCCATCTTTCTCCGTGGTTTTCGCATCGACCGGGGAAGTTGTGAAATACAAAAGGGTTGTCAAAAACGTGGGAAGCAATG
TCGACGCTGTGTACGAAGTCGGAGTTAAATCTCCGGCGAATGTTGAGATTGATGTTTCTCCAAGCAAGCTTGCGTTCAGC
AAGGAGAAGAGCGTGTTGGAGTATGAAGTCACATTTAAGAGCGTTGTGCTCGGCGGAGGAGTCGGATCCGTGCCGGGTCA
TGAATTCGGGTCGATCGAATGGACAGACGGTGAACACGTTGTTAAGAGTCCGGTGGCCGTCCAATGGGGTCAGGGATCAG
TTCAGTCCTTCTGA