Details for Arabidopsis Locus AT3G14050

Position : Chr3 ( 5`- 4650757 .. 4653914 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14050

Protein [Map View]
MVVATTIALYASPPSSVCSTPHQISCDLDLTSRSSSTSSSMASSPQKPIVGGLSSLFSSASVKSSSSSSCSYSTGVDEFS
SLRYDRSDDLKDLSFSSSFGYSPAKFVNSFRRDHQSPISVLHGPVSCSCSPPMRMSRDRNLDGSFRLGASGLFNGFVRKA
LGSCVDYEFGSDSVLVDELTFPMEVDTIKPYARDLLRRAQLRHKIFNDESVIKAFYEAEKAHRGQMRASRDPYLQHCVET
AMLLANIGANSTVVVAGLLHDTIDDSFMSYDYILRNFGAGVADLVEGVSKLSQLSKLARENNTACKTVEADRLHTMFLAM
ADARAVLIKLADRLHNMKTLYALSPVKQQRFAKETLEIFAPLANRLGISTWKVQLENLCFKHLYPNQHNEMSTMLEDSFD
EAMITSAIEKLEQALKKAGISYHVLCGRHKSLYSIYSKMLKKKLTVDEIHDIHGLRLIVDNEGDCYKALGVVHSLWSEVP
GKLKDYITHPKFNGYQSLHTVVMDNGTVPLEVQIRTQEMHLQAEFGFAAHWRYKEGGCKYSSFVLQMVEWARWVVTWHCE
AMSKDRSSISSSDSIKPPCKFPSHSEDCPASYKPNSSQDGPVYVIVIENDKMSVQEFPASSTVSDLLSRAGPGSSRWSMY
GIPAKEELRPRLNQIPVSDLKWKLKMGDVVELTPTIPDESLTEYREEIQRMYDRGLAFSRPGTMVGWGS*

DNA
ATGGTGGTGGCGACGACTATAGCACTTTACGCGAGTCCACCAAGCAGCGTTTGTTCCACGCCACATCAGATCTCATGTGA
TCTCGATCTCACCTCCAGGAGTTCGTCAACATCCTCTTCCATGGCTTCCTCGCCGCAGAAACCAATCGTTGGAGGTCTCT
CTTCACTTTTCTCCAGCGCATCAGTCAAATCTTCATCTTCTTCCTCTTGCTCATACTCAACCGGAGTAGATGAGTTCTCT
TCACTACGCTATGATCGGAGTGATGATTTGAAAGATCTGAGCTTTAGCAGCTCCTTTGGTTATTCTCCGGCGAAATTTGT
GAATTCATTTAGACGAGATCACCAAAGCCCTATCTCTGTGCTTCATGGTCCGGTCTCGTGTAGTTGTAGCCCTCCGATGA
GAATGTCTCGTGATCGGAATCTAGATGGTTCGTTTCGTTTAGGAGCTAGTGGATTGTTCAATGGTTTCGTTAGGAAAGCT
CTTGGATCATGTGTTGATTACGAGTTCGGATCGGATTCTGTTCTCGTTGATGAGCTAACGTTTCCTATGGAGGTTGATAC
GATAAAGCCATATGCTAGGGATTTGCTAAGACGTGCACAATTGAGACACAAGATTTTCAATGATGAATCTGTGATCAAAG
CTTTTTATGAAGCAGAGAAAGCTCATAGAGGACAAATGAGAGCTAGTCGTGATCCTTACCTTCAGCATTGTGTTGAGACT
GCTATGTTGTTGGCTAATATCGGAGCTAACTCAACTGTTGTTGTTGCTGGCCTTCTTCATGATACCATTGACGATTCTTT
CATGAGCTATGATTATATTCTCAGAAACTTCGGAGCAGGAGTTGCTGATTTGGTTGAAGGGGTTTCGAAGCTTAGCCAAT
TGAGCAAACTCGCTAGAGAGAACAATACGGCGTGTAAAACTGTTGAAGCAGATCGTTTGCACACAATGTTTCTTGCAATG
GCAGATGCAAGAGCTGTTCTTATAAAACTGGCTGATCGATTACACAACATGAAGACGCTTTACGCTTTGTCCCCAGTGAA
GCAGCAGAGGTTTGCTAAAGAGACGTTGGAAATATTTGCACCTTTGGCTAATCGTTTGGGAATCTCTACCTGGAAAGTTC
AGCTTGAAAATCTTTGTTTCAAACATCTTTACCCAAACCAGCATAATGAGATGTCAACCATGCTCGAGGATTCATTCGAT
GAAGCCATGATTACTTCTGCAATAGAGAAATTGGAGCAAGCTCTTAAGAAAGCAGGCATTTCTTATCATGTTCTTTGTGG
CCGGCACAAGAGCTTGTATAGTATTTACAGCAAGATGTTAAAGAAAAAGCTAACAGTGGATGAAATTCATGACATTCATG
GGTTACGTTTGATTGTTGACAACGAAGGAGATTGTTACAAGGCCTTAGGAGTAGTTCATAGTTTATGGTCTGAAGTTCCT
GGAAAGCTGAAGGATTACATAACTCATCCCAAATTCAACGGGTATCAATCTTTGCACACGGTAGTGATGGACAATGGAAC
AGTTCCACTTGAAGTCCAAATACGTACACAGGAGATGCATTTGCAAGCAGAATTTGGGTTTGCAGCTCATTGGAGATACA
AGGAAGGTGGCTGCAAATACTCTTCGTTTGTGCTTCAGATGGTTGAATGGGCTCGGTGGGTCGTAACCTGGCATTGCGAA
GCAATGAGCAAAGACCGATCTTCCATAAGTTCTTCAGATTCCATCAAACCCCCTTGCAAGTTTCCGTCTCACTCTGAGGA
CTGCCCAGCTTCTTACAAGCCTAACAGTAGCCAGGATGGACCAGTCTATGTCATTGTAATCGAAAATGATAAGATGTCTG
TGCAAGAATTTCCAGCGAGTTCAACAGTCTCGGATCTGCTGAGCCGGGCGGGGCCAGGGAGCTCGAGGTGGTCCATGTAT
GGCATACCAGCAAAGGAAGAACTAAGGCCAAGACTGAACCAAATACCTGTAAGTGACCTCAAGTGGAAGCTGAAGATGGG
TGATGTGGTGGAGCTGACTCCAACAATTCCTGATGAGTCTCTGACTGAATACAGAGAAGAGATTCAACGCATGTATGATC
GAGGACTCGCGTTTTCCCGCCCCGGAACCATGGTCGGATGGGGAAGCTGA