Details for Arabidopsis Locus AT3G14020

Position : Chr3 ( 5`- 4642280 .. 4644301 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14020

Protein [Map View]
MQEFHSSKDSLPCPATSWDNSVFTNSNVQGSSSLTDNNTLSLTMEMKQTGFQMQHYDSSSTQSTGGESYSEVASLSEPTN
RYGHNIVVTHLSGYKENPENPIGSHSISKVSQDSVVLPIEAASWPLHGNVTPHFNGFLSFPYASQHTVQHPQIRGLVPSR
MPLPHNIPENEPIFVNAKQYQAILRRRERRAKLEAQNKLIKVRKPYLHESRHLHALKRVRGSGGRFLNTKKHQESNSSLS
PPFLIPPHVFKNSPGKFRQMDISRGGVVSSVSTTSCSDITGNNNDMFQQNPQFRFSGYPSNHHVSVLM*

DNA
ATGCAAGAGTTCCATAGTAGCAAAGATTCATTGCCTTGTCCTGCAACTTCTTGGGATAACTCTGTCTTCACCAACTCAAA
TGTCCAAGGATCATCATCCTTGACCGATAACAACACTTTAAGCTTGACAATGGAGATGAAACAAACTGGTTTTCAAATGC
AGCACTATGATTCCTCCTCTACTCAATCCACTGGAGGAGAATCATATAGTGAAGTTGCTAGCTTAAGTGAACCTACTAAT
CGTTATGGCCACAACATTGTTGTCACTCATCTCTCAGGTTACAAAGAAAACCCGGAAAATCCTATTGGAAGTCATTCGAT
ATCAAAGGTGTCTCAAGATTCAGTGGTTCTTCCTATTGAGGCGGCTTCTTGGCCTTTACACGGCAATGTAACGCCACATT
TCAATGGTTTCTTGTCTTTTCCTTATGCATCACAACACACGGTGCAGCATCCTCAAATCAGAGGGTTGGTTCCGTCTAGA
ATGCCTTTGCCTCACAACATTCCAGAGAACGAACCAATTTTCGTCAATGCAAAACAGTACCAAGCCATTCTCCGCCGCAG
AGAGCGCCGTGCAAAGCTTGAAGCTCAGAACAAGCTCATCAAAGTCCGCAAACCATATCTTCACGAGTCGCGGCACCTCC
ATGCACTAAAGAGAGTTAGAGGCTCTGGTGGACGTTTCCTCAACACAAAGAAGCATCAAGAATCAAATTCCTCACTATCT
CCTCCATTCTTGATTCCACCTCATGTCTTCAAGAACTCTCCAGGAAAGTTCCGGCAAATGGACATTTCAAGGGGTGGGGT
TGTGTCTAGTGTCTCGACAACATCTTGCTCGGACATAACCGGGAACAACAACGACATGTTCCAGCAAAACCCACAATTCA
GGTTCTCAGGTTATCCATCAAACCACCATGTCTCAGTCCTCATGTGA