Details for Arabidopsis Locus AT3G13970

Position : Chr3 ( 5`- 4613506 .. 4614848 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13970

Protein [Map View]
MATESPNSVQKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGFD
GKLVVNYACSMAWG*

DNA
ATGGCGACCGAATCTCCGAATTCTGTTCAGAAAATTGTTGTTCATCTGCGAGCTACTGGTGGTGCTCCGATACTGAAACA
ATCTAAATTCAAGGTTTCAGGGAGTGACAAGTTTGCTAACGTGATTGATTTTCTAAGACGGCAGCTTCACTCTGACTCAT
TGTTTGTTTATGTGAACAGCGCTTTCTCGCCAAACCCGGATGAATCAGTAATTGATCTATACAATAACTTTGGGTTTGAT
GGTAAACTGGTGGTGAACTATGCTTGTTCCATGGCATGGGGTTAA