Details for Arabidopsis Locus AT3G13920

Position : Chr3 ( 5`- 4592256 .. 4594999 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13920

Protein [Map View]
MAGSAPEGTQFDARQFDQKLNEVLEGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVI
QQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHV
VVGTPGRVFDMLKRQSLRADNIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRI
LVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDII
MREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLCLRTWPICCE
GRKEVGSVAVFALPY*

DNA
ATGGCAGGATCTGCACCAGAAGGCACACAGTTTGATGCACGTCAGTTTGACCAGAAACTCAATGAAGTACTTGAGGGACA
AGATGAGTTCTTCACATCCTATGATGATGTTCATGAGAGCTTTGATGCCATGGGTCTTCAAGAGAACCTTCTCAGGGGTA
TTTATGCTTATGGTTTTGAGAAGCCTTCTGCTATTCAGCAAAGAGGAATCGTCCCCTTCTGTAAGGGTCTTGATGTGATT
CAACAGGCTCAGTCTGGTACTGGGAAAACAGCAACTTTCTGCTCTGGTGTCTTGCAGCAGCTGGACTTCTCCCTTATCCA
GTGTCAGGCTTTGGTTCTAGCTCCAACTAGAGAGCTTGCTCAGCAAATTGAGAAGGTCATGAGGGCCCTTGGTGATTACC
TTGGTGTCAAGGTTCACGCCTGTGTTGGTGGAACCAGTGTCCGTGAGGATCAGCGCATCCTCCAAGCTGGTGTCCATGTT
GTTGTTGGAACTCCAGGGCGTGTCTTTGACATGTTGAAGAGGCAGTCTCTTCGTGCTGACAACATCAAGATGTTTGTTCT
CGATGAAGCTGATGAAATGCTCTCCCGTGGTTTCAAGGACCAGATCTATGACATATTCCAGCTTCTTCCACCAAAGATCC
AAGTTGGTGTGTTCTCCGCAACAATGCCACCAGAAGCTCTTGAGATCACAAGGAAGTTCATGAGCAAGCCAGTGAGAATC
TTGGTGAAGCGTGATGAGCTTACCCTTGAAGGTATCAAGCAGTTCTACGTCAACGTTGAGAAAGAAGAGTGGAAGCTCGA
GACACTCTGTGATCTCTACGAGACTCTTGCCATCACTCAGAGTGTCATCTTCGTGAACACCAGGCGTAAGGTTGATTGGC
TCACAGACAAAATGAGAAGCCGTGACCACACAGTCTCTGCAACTCACGGAGACATGGACCAGAACACCAGGGACATCATC
ATGAGAGAGTTCAGGTCTGGTTCCTCCCGTGTTCTCATCACCACTGACCTCTTAGCTCGTGGTATTGATGTCCAACAAGT
CTCCCTGGTTATCAACTTCGATCTCCCAACTCAGCCAGAGAACTACCTTCACCGTATCGGAAGAAGTGGAAGGTTCGGGA
GAAAGGGTGTTGCGATCAATTTCGTGACCCGTGATGATGAGAGGATGCTCTGCCTTCGAACGTGGCCGATCTGCTGTGAA
GGGAGAAAAGAAGTCGGTTCTGTTGCTGTGTTTGCTCTGCCGTACTAG