Details for Arabidopsis Locus AT3G13910

Position : Chr3 ( 5`- 4590919 .. 4591483 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13910

Protein [Map View]
MANYYEPPASGNRRDAVKGYNSGSFDDSAGDQSQTNDYQLKIKKSKSVPNADRAASRSWSFSDPESRRKRRVAGYKVYSV
EQKMKGSIRKSFKWFKDIIGIS*

DNA
ATGGCGAATTATTACGAACCGCCAGCTTCTGGAAACCGTCGAGACGCAGTGAAAGGTTACAACAGCGGGAGCTTCGACGA
TTCAGCCGGCGATCAGAGTCAAACGAACGATTACCAGTTAAAGATAAAGAAAAGCAAAAGCGTTCCAAACGCGGATCGTG
CGGCGTCAAGAAGCTGGAGTTTCAGCGATCCAGAATCGCGGAGGAAGAGAAGAGTCGCTGGCTACAAAGTTTATTCCGTT
GAACAGAAGATGAAGGGATCCATTCGAAAGAGCTTCAAATGGTTCAAAGACATTATCGGTATTTCTTGA