Details for Arabidopsis Locus AT3G13898

Position : Chr3 ( 5`- 4584011 .. 4584487 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13898

Protein [Map View]
MEYMFLLMSKFFFVFPIIIYIGPAEIIKPQAAEENSRRRILNPNENKEEIVKRRRRIGSKPPSCEKKCYGCEPCEAIQFP
TISSIPHLSPHYANYQPEGWRCHCPPP*

DNA
ATGGAATACATGTTCTTATTAATGTCTAAATTCTTTTTCGTTTTCCCAATAATAATTTATATTGGGCCTGCAGAGATAAT
AAAGCCGCAGGCTGCAGAAGAAAACTCTAGGAGACGCATTTTGAACCCCAATGAGAATAAAGAAGAGATAGTGAAAAGAA
GAAGAAGAATAGGATCAAAGCCACCAAGTTGTGAGAAAAAATGCTATGGATGTGAGCCATGTGAAGCAATCCAATTCCCT
ACCATTTCTTCAATCCCTCACCTATCTCCTCATTATGCTAATTACCAACCTGAGGGTTGGAGATGCCATTGTCCTCCTCC
TTAA