Details for Arabidopsis Locus AT3G13880

Position : Chr3 ( 5`- 4572180 .. 4574490 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13880

Protein [Map View]
MLLQFRAKTFFNNIAQDSLVTLITKRVGLGYRFLSSLCQPKNTALDSEGYKILFQTAAKSGSVVLGKLAHGHMIKSSLNP
CLYLLNNLLNMYCKCRELGFARQLFDRMPERNIISFNSLISGYTQMGFYEQAMELFLEAREANLKLDKFTYAGALGFCGE
RCDLDLGELLHGLVVVNGLSQQVFLINVLIDMYSKCGKLDQAMSLFDRCDERDQVSWNSLISGYVRVGAAEEPLNLLAKM
HRDGLNLTTYALGSVLKACCINLNEGFIEKGMAIHCYTAKLGMEFDIVVRTALLDMYAKNGSLKEAIKLFSLMPSKNVVT
YNAMISGFLQMDEITDEASSEAFKLFMDMQRRGLEPSPSTFSVVLKACSAAKTLEYGRQIHALICKNNFQSDEFIGSALI
ELYALMGSTEDGMQCFASTSKQDIASWTSMIDCHVQNEQLESAFDLFRQLFSSHIRPEEYTVSLMMSACADFAALSSGEQ
IQGYAIKSGIDAFTSVKTSSISMYAKSGNMPLANQVFIEVQNPDVATYSAMISSLAQHGSANEALNIFESMKTHGIKPNQ
QAFLGVLIACCHGGLVTQGLKYFQCMKNDYRINPNEKHFTCLVDLLGRTGRLSDAENLILSSGFQDHPVTWRALLSSCRV
YKDSVIGKRVAERLMELEPEASGSYVLLHNIYNDSGVNSSAEEVRELMRDRGVKKEPALSWIVIGNQTHSFAVADLSHPS
SQMIYTMLETMDNVDFVDYTLVHFCSVT*

DNA
ATGTTGTTACAGTTCCGAGCAAAGACTTTTTTCAACAACATTGCTCAAGATTCTCTGGTTACTCTTATCACCAAACGAGT
TGGATTGGGTTACAGGTTTTTGTCTTCGTTATGCCAACCAAAGAACACGGCTTTAGATTCCGAAGGTTACAAGATACTTT
TTCAGACAGCTGCAAAATCAGGCTCCGTGGTACTGGGAAAGCTCGCTCATGGACACATGATCAAGTCCTCCTTGAACCCG
TGTCTGTACTTGCTCAACAATCTTCTGAACATGTATTGCAAGTGCCGGGAATTGGGTTTTGCACGCCAGTTGTTCGACAG
AATGCCTGAACGAAACATTATTTCTTTTAATTCTTTGATTTCTGGGTACACTCAGATGGGATTTTATGAACAGGCCATGG
AATTGTTTCTTGAAGCTAGAGAAGCTAATTTGAAGCTCGATAAGTTCACGTATGCCGGTGCATTGGGCTTTTGTGGAGAA
AGGTGTGATCTTGATTTAGGGGAATTGTTGCACGGGTTGGTTGTTGTGAATGGTCTATCTCAGCAAGTGTTTTTGATCAA
TGTGTTGATTGACATGTATAGTAAGTGTGGAAAGCTTGACCAAGCTATGTCTTTATTTGATAGATGCGATGAAAGGGATC
AAGTTTCATGGAATTCTTTGATTTCCGGTTATGTTCGGGTTGGCGCAGCGGAAGAACCGCTAAATCTGTTGGCTAAAATG
CATAGAGACGGCCTAAATCTGACTACGTATGCTCTGGGGAGTGTGCTAAAGGCTTGTTGTATTAACCTGAACGAAGGATT
TATAGAAAAAGGTATGGCAATTCACTGTTATACAGCAAAACTAGGAATGGAGTTTGATATAGTTGTCCGTACTGCATTGC
TTGACATGTATGCCAAAAACGGAAGTTTGAAAGAGGCGATAAAGCTTTTCAGTTTGATGCCTTCGAAGAATGTGGTTACG
TATAACGCAATGATATCTGGGTTTCTCCAAATGGATGAAATAACCGATGAAGCTTCTAGTGAAGCCTTTAAGCTCTTCAT
GGATATGCAAAGACGGGGTTTGGAACCCTCGCCATCGACATTTTCAGTTGTGCTCAAAGCTTGTAGTGCAGCGAAAACCT
TGGAATATGGAAGGCAGATTCACGCTCTCATCTGTAAGAACAATTTTCAGTCTGATGAGTTTATTGGGAGCGCTCTAATC
GAGCTGTATGCGTTAATGGGTTCAACTGAAGATGGAATGCAATGCTTTGCTTCAACATCAAAGCAAGATATCGCCTCATG
GACATCGATGATAGATTGCCATGTCCAAAACGAGCAGCTTGAAAGCGCATTTGATCTGTTCCGACAACTTTTTTCATCCC
ATATAAGACCAGAAGAGTATACAGTTTCCCTTATGATGAGTGCTTGTGCTGATTTTGCTGCATTAAGCTCAGGAGAGCAG
ATTCAGGGTTATGCCATAAAGAGTGGAATTGATGCTTTCACCAGTGTTAAGACGTCAAGCATTTCTATGTATGCAAAGTC
AGGTAACATGCCGCTTGCTAATCAAGTATTTATCGAGGTCCAAAACCCAGACGTTGCAACATACTCGGCTATGATCTCAA
GCCTTGCTCAACACGGTTCTGCTAACGAAGCCTTAAACATCTTTGAATCGATGAAAACCCACGGAATTAAACCGAACCAG
CAAGCCTTTCTCGGTGTTCTAATAGCTTGTTGCCACGGAGGATTAGTCACACAAGGACTAAAGTATTTCCAATGCATGAA
GAACGATTACAGGATTAACCCAAACGAGAAACATTTCACTTGCCTCGTCGATCTTTTAGGTCGCACGGGAAGATTATCAG
ATGCTGAGAATCTGATTTTGAGCTCTGGTTTTCAAGACCATCCAGTGACGTGGAGAGCATTACTGAGTTCTTGTAGAGTT
TACAAAGACAGCGTAATTGGGAAACGCGTTGCGGAGAGACTGATGGAACTTGAACCCGAGGCCTCTGGCTCATACGTATT
GCTCCACAACATTTACAACGATTCTGGAGTCAATTCTTCAGCAGAGGAGGTGAGAGAACTGATGAGAGATCGAGGGGTTA
AGAAAGAACCAGCCTTGAGCTGGATCGTAATCGGTAACCAAACTCATTCCTTCGCCGTCGCTGATTTGTCTCACCCTTCG
AGCCAGATGATCTACACAATGTTAGAGACCATGGACAATGTAGATTTTGTAGATTACACTCTTGTTCATTTTTGTTCTGT
TACATGA