Details for Arabidopsis Locus AT3G13870

Position : Chr3 ( 5`- 4565412 .. 4571260 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13870

Protein [Map View]
MDAACSTQLIDGDGVFNVSGVDHFIKEVKLDECGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFRGRSQTTKGIWI
ARCAGIEPCTVVMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRK
TTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHKETPLSDFFNVEVVALSSYEEKEEQFKEQVYNLRQRFFQSV
APGGLAGDRRGVVPANAFAFSAKQMWQVIKDNKDLDLPAHKVMVATVRCEEIANEKFSSFIANENWRELEEAVQSGPVSG
FGRKLSSILQASLSEYDTEATYFEESVRSSKRQQLQEKLLQLVQPTFQDVLGHLRAGALENFKNAFEKALDAGEGFSSSA
KSCAQSCISKFDKGCEEAVIEQAKWDTSKTREKLERDIEAHISSVRTAKLAELTTLYESKLNVALSGPVEALLDGANDET
WPAIRKLLRREGELAVYGLSNALSGFEMDEETRSKMLADLENYARGIVETKAKEEAGRAMMRMKDRFATIFSHDSDSMPR
VWTGKEDIRAITKMARSASLKLLSVMAVIRLDDELDNIEKTLTLALFNSTGNNATSKSISTIDSLASSTWEKVAPEKTLI
TPVQCKSLWRQFKNETEYTVTQAISAQEANRRNNNWLPPPWAILALVVLGFNEFMTLLRNPLWLLVLFVGYLVSKALWVQ
LNISGEFQNGVLPGLLSLSTKFIPTVMNLLKKLAEEGQAPPTNSNQSMNSTAQSEVTTNGESSSSSSSGSSPAKNVPIDT
SA*

DNA
ATGGATGCCGCTTGCTCTACCCAGCTTATCGATGGGGATGGTGTCTTTAATGTTTCTGGGGTTGATCATTTCATCAAGGA
GGTTAAATTGGACGAATGTGGTCTTTCATACGCGGTTGTCTCGATTATGGGTCCACAAAGTAGTGGGAAGAGTACGCTCT
TGAATCATTTGTTTGGAACCAACTTTAGAGAAATGGATGCATTTAGAGGAAGGTCTCAGACGACTAAGGGAATTTGGATT
GCTAGATGCGCTGGTATTGAGCCTTGCACCGTTGTGATGGATTTAGAGGGTACCGATGGGAGAGAGCGTGGTGAGGATGA
TACTGCTTTCGAGAAACAGAGTGCTCTTTTTGCACTTGCAGTCTCAGACATAGTTCTTATAAACATGTGGTGTCATGATA
TTGGTCGGGAACAAGCAGCAAATAAACCTCTTTTAAAGACTGTGTTCCAGGTTATGATGCGGTTGTTTAGTCCGCGGAAG
ACAACTTTGATGTTTGTTATAAGAGATAAAACACGGACGCCACTGGAAAATTTAGAACCAGTGCTGAGGGAAGACATTCA
AAAGATATGGGATTCAGTTCCCAAGCCTCAGGCCCACAAAGAAACTCCACTTAGCGATTTCTTCAATGTTGAAGTAGTTG
CTCTCTCGAGTTATGAAGAAAAAGAAGAGCAATTCAAAGAGCAGGTCTACAATTTGAGACAACGGTTCTTCCAATCTGTC
GCACCTGGCGGGCTTGCTGGTGATCGACGAGGAGTTGTCCCTGCCAATGCTTTTGCTTTTAGTGCAAAACAGATGTGGCA
AGTCATCAAAGACAACAAAGACTTGGATCTTCCAGCACACAAGGTCATGGTAGCAACTGTGCGATGTGAGGAAATTGCCA
ATGAAAAATTCTCTAGTTTTATCGCGAATGAGAATTGGCGCGAGTTGGAAGAGGCTGTACAGTCTGGTCCTGTTTCCGGA
TTTGGAAGAAAGCTGAGCTCAATTCTCCAAGCAAGCTTATCAGAGTATGACACAGAAGCGACATACTTTGAAGAAAGTGT
TAGATCATCCAAGAGGCAACAGCTGCAAGAAAAGTTATTGCAACTTGTTCAACCAACTTTCCAAGACGTGCTTGGACATT
TGAGGGCTGGAGCACTTGAAAACTTCAAGAATGCTTTTGAGAAGGCCTTGGATGCTGGAGAAGGGTTTTCATCATCTGCG
AAATCCTGCGCTCAGTCATGCATATCTAAGTTTGATAAAGGATGTGAAGAGGCTGTTATTGAACAAGCAAAATGGGATAC
ATCTAAAACTCGGGAAAAGCTTGAGCGTGATATTGAAGCTCATATCTCTTCTGTCCGTACTGCAAAGTTGGCTGAACTGA
CTACTCTGTATGAGTCAAAACTAAATGTAGCCTTATCTGGACCGGTGGAAGCTCTTCTGGATGGGGCTAATGATGAAACA
TGGCCAGCAATAAGAAAGCTACTTAGACGGGAAGGAGAATTGGCTGTCTATGGTCTCTCCAACGCATTATCTGGTTTCGA
AATGGACGAAGAAACACGGAGTAAAATGCTTGCTGATCTCGAGAACTATGCACGAGGTATTGTTGAAACCAAGGCAAAGG
AAGAGGCTGGAAGAGCGATGATGCGCATGAAGGATAGATTTGCTACAATCTTCAGCCATGATTCTGATTCAATGCCACGT
GTTTGGACTGGAAAGGAGGACATCAGAGCAATTACAAAAATGGCTCGTTCTGCGTCCTTGAAGCTGCTGTCTGTTATGGC
TGTTATACGCTTGGATGATGAACTCGACAATATTGAGAAGACATTGACGCTAGCTCTGTTTAATTCTACGGGCAACAATG
CTACTAGCAAGAGCATCAGCACAATTGATTCACTTGCCTCAAGCACTTGGGAGAAGGTTGCACCAGAAAAGACGTTGATC
ACACCTGTGCAGTGTAAATCACTGTGGAGGCAATTTAAGAACGAGACAGAATATACCGTTACACAGGCCATTTCTGCACA
GGAAGCTAACCGACGGAATAACAACTGGCTGCCACCTCCATGGGCAATCCTTGCCCTGGTTGTTCTTGGATTTAATGAAT
TTATGACTCTCTTAAGAAATCCTCTATGGCTCTTAGTTCTATTTGTCGGATACCTTGTATCCAAAGCCTTGTGGGTGCAA
TTAAATATTTCAGGAGAATTCCAAAACGGCGTGCTACCTGGACTTCTCTCTTTGTCAACCAAATTCATTCCAACGGTCAT
GAACCTCCTCAAAAAGCTTGCGGAAGAAGGACAAGCACCACCCACAAATAGCAACCAATCAATGAACTCTACAGCTCAAT
CCGAGGTTACAACCAATGGAGAAAGCAGCAGCAGCAGTAGCTCTGGTTCATCTCCAGCAAAAAACGTACCCATTGATACA
AGTGCATAG