Details for Arabidopsis Locus AT3G13845

Position : Chr3 ( 5`- 4557321 .. 4558579 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13845

Protein [Map View]
MSVKPTVALRGILVGGVAIFAKVAAAMKAAGGVKLGAAATAMTVAATAAVSGGSKQDQKQDASKAPPPSK*

DNA
ATGTCGGTGAAACCCACAGTTGCTTTGAGAGGTATCTTAGTAGGTGGAGTGGCGATATTTGCAAAAGTTGCGGCTGCAAT
GAAAGCAGCTGGAGGTGTTAAGCTTGGTGCAGCTGCTACAGCTATGACCGTGGCTGCAACCGCTGCTGTTAGTGGAGGTT
CTAAGCAAGATCAAAAGCAAGATGCTTCCAAGGCACCACCACCTTCTAAATAA