Details for Arabidopsis Locus AT3G13840

Position : Chr3 ( 5`- 4555305 .. 4556837 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13840

Protein [Map View]
MLLEETEPPNQTLDHVLSWLEDSVSLSPLPGFDDSYLLHEFDGSQTWEWDQTQDPEHGFIQSYSQDLSAAYVGCEATNLE
VVTEAPSIDLDLPPEIQQPNDQSRKRSHDGFLEAQQVKKSARSKRKAIKSSEKSSKDGNKEGRWAEKLLNPCALAITASN
SSRVQHYLCVLSELASSSGDANRRLAAFGLRALQHHLSSSSVSSSFWPVFTFASAEVKMFQKTLLKFYEVSPWFALPNNM
ANSAILQILAQDPKDKKDLHIIDIGVSHGMQWPTLLEALSCRLEGPPPRVRITVISDLTADIPFSVGPPGYNYGSQLLGF
ARSLKINLQISVLDKLQLIDTSPHENLIVCAQFRLHHLKHSINDERGETLKAVRSLRPKGVVLCENNGECSSSADFAAGF
SKKLEYVWKFLDSTSSGFKEENSEERKLMEGEATKVLMNAGDMNEGKEKWYERMREAGFFVEAFEEDAVDGAKSLLRKYD
NNWEIRMEDGDTFAGLMWKGEAVSFCSLWK*

DNA
ATGTTGTTGGAAGAAACAGAACCACCAAACCAGACTCTAGATCATGTCCTAAGCTGGCTTGAGGATTCTGTGTCCTTATC
CCCATTACCAGGATTTGATGATTCTTATTTGCTCCACGAGTTTGATGGGTCTCAAACGTGGGAATGGGATCAGACTCAAG
ATCCGGAGCATGGTTTTATTCAAAGCTATAGTCAAGATCTTAGTGCAGCATATGTTGGTTGTGAAGCAACTAACCTGGAA
GTGGTAACAGAAGCTCCATCCATTGATTTGGATCTTCCACCTGAAATTCAGCAACCAAACGATCAGTCCAGGAAAAGGAG
CCACGACGGGTTTCTCGAGGCACAACAGGTGAAAAAATCGGCAAGGAGCAAGAGAAAAGCAATCAAGTCTAGTGAGAAGA
GCTCCAAAGATGGTAACAAGGAAGGGAGATGGGCAGAGAAGTTGCTTAACCCTTGTGCCTTGGCCATTACGGCAAGTAAC
TCATCAAGGGTTCAACATTACCTTTGTGTTCTCTCTGAACTGGCCTCTTCTTCTGGTGATGCTAATCGTCGGCTTGCAGC
TTTTGGTCTTCGGGCTTTGCAACATCATCTTTCCTCATCCTCTGTGTCATCATCCTTTTGGCCTGTTTTTACTTTTGCTT
CAGCGGAAGTGAAGATGTTTCAAAAGACTCTGCTTAAGTTCTACGAGGTAAGCCCTTGGTTTGCTTTGCCTAACAACATG
GCAAACTCAGCTATCCTGCAGATTTTAGCACAGGATCCCAAAGATAAAAAGGATCTTCATATTATTGATATTGGTGTTTC
TCACGGTATGCAATGGCCCACTTTGTTGGAGGCTCTGAGCTGCAGACTAGAAGGACCTCCTCCTCGTGTTCGAATAACCG
TTATATCAGATCTAACCGCAGACATACCTTTCTCTGTTGGTCCACCAGGTTACAATTATGGTTCTCAACTCCTAGGCTTT
GCTCGGTCTCTCAAGATCAACCTTCAGATTAGTGTACTTGACAAGTTACAACTCATTGATACCTCACCTCACGAGAACTT
AATCGTGTGTGCTCAGTTTAGGCTGCATCACCTGAAGCATAGCATCAATGATGAGAGAGGCGAGACTTTGAAAGCAGTGA
GAAGTTTAAGGCCAAAAGGAGTGGTTCTTTGTGAGAACAATGGAGAATGCAGTAGTAGTGCGGACTTTGCAGCAGGATTC
TCGAAGAAACTGGAGTATGTATGGAAGTTTCTGGATTCAACAAGCTCGGGATTTAAAGAAGAGAATAGCGAAGAGAGAAA
ACTAATGGAAGGAGAGGCAACAAAGGTGTTGATGAATGCAGGAGATATGAATGAAGGAAAAGAGAAATGGTATGAGAGGA
TGAGAGAAGCTGGTTTTTTTGTAGAAGCATTTGAAGAAGATGCAGTTGATGGAGCCAAATCCTTACTAAGAAAGTATGAC
AACAATTGGGAAATAAGAATGGAAGATGGAGATACCTTTGCTGGATTAATGTGGAAAGGAGAGGCAGTTTCCTTTTGTTC
ATTGTGGAAGTAG