Details for Arabidopsis Locus AT3G13820

Position : Chr3 ( 5`- 4549616 .. 4550863 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13820

Protein [Map View]
MTTMSNLPAEVLEEILSRTPVTSLRTMRSTCKKWNNLSKKKIIPEAARKQQGLMLIKKKICSLSFSLHEIHKDDYVVPCI
NQVDIPRNIEVEKIFHCDGILLCVIEDNCSLLVWNPYLGQTRRIEVSSDADMNDRYALGYDNNNSSHKILRIKKDFKNSD
GLGYEIYRFASNSWSLLDEEVMKPEWDVWSVQRSSVSLKGNTYFLLQGNDYDDQEDEEEEDDEEYEDDDDVLPKDNFLLC
FDYTTERFGPRLLLPFNPHVEETVALSCIGEERLVMLYQSFKTYKGIEIWVTDKIDPKAVSWSKFLKVDITPLTGFPVDF
YADSFVIDEEKKVAAVFDIHCSYQKAHIIGEDGYLKCVNMGRASDVGNGQPLVFSSYVPSLVKVPVKQPKGKRKGRSSET
KSNKNKKGRKIKIIG*

DNA
ATGACGACGATGTCTAATCTCCCTGCAGAGGTTTTGGAAGAGATTCTCTCAAGGACTCCGGTTACATCTCTGAGGACAAT
GCGATCTACTTGCAAAAAGTGGAACAATCTCTCAAAAAAGAAGATTATTCCTGAAGCTGCAAGGAAGCAGCAAGGTTTAA
TGTTGATTAAAAAGAAAATCTGTTCCTTGAGTTTCAGTCTCCATGAAATTCACAAGGATGACTACGTCGTTCCGTGCATT
AATCAGGTCGATATTCCTCGCAACATAGAAGTAGAGAAAATCTTTCACTGTGACGGCATATTGTTATGCGTCATAGAGGA
CAACTGTAGTCTTTTGGTATGGAATCCATATCTAGGGCAAACGAGGAGGATCGAAGTAAGTTCCGATGCCGACATGAATG
ATAGGTATGCTCTTGGTTACGACAACAACAACAGTAGCCACAAAATCTTGAGGATTAAGAAAGATTTTAAGAACAGCGAC
GGTTTAGGATACGAAATCTACAGATTCGCGTCGAATTCATGGAGTTTGCTTGATGAGGAAGTGATGAAACCAGAGTGGGA
TGTATGGTCTGTTCAACGAAGCTCCGTGTCTTTGAAGGGAAATACGTATTTCTTACTTCAAGGGAATGATTATGATGACC
AAGAGGACGAAGAGGAGGAAGATGACGAAGAGTACGAAGATGACGACGACGTCCTGCCGAAAGATAATTTTTTGCTCTGT
TTTGATTATACAACAGAGAGATTTGGTCCGCGTCTGCTTCTACCGTTTAACCCTCATGTTGAAGAGACTGTGGCTTTATC
TTGTATAGGAGAAGAGCGGCTCGTAATGCTATATCAAAGCTTCAAGACATATAAGGGAATAGAGATTTGGGTTACAGACA
AGATTGATCCGAAAGCGGTGTCGTGGAGCAAGTTTCTGAAAGTGGATATCACACCACTCACTGGTTTTCCGGTTGACTTT
TACGCTGATAGTTTCGTCATTGACGAGGAGAAGAAAGTTGCTGCGGTTTTCGATATACATTGTAGCTACCAAAAAGCTCA
CATCATTGGAGAAGATGGATACCTGAAATGTGTGAATATGGGAAGAGCTTCGGATGTTGGAAATGGTCAGCCACTTGTGT
TCTCTTCTTATGTTCCAAGTTTAGTGAAAGTTCCTGTCAAGCAACCAAAGGGTAAAAGAAAAGGTAGATCTTCTGAAACC
AAAAGCAACAAGAACAAAAAAGGAAGAAAGATTAAGATTATTGGTTAA