Details for Arabidopsis Locus AT3G13800

Position : Chr3 ( 5`- 4538767 .. 4541487 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13800

Protein [Map View]
MAAMSAVLSLGLGTLRPSHRSLSCFDSLRHHQTSFLRCHQSLISRNTTRSPLNKILQACLQSNSANGDALVSSSDESSEI
VFMGTGTSEGIPRVSCLTNPLKTCSVCTKATEPGNRNRRLNTSILVRYIRPSGTSNILIDCGKFFYHSALRWFPTFGLRT
LDAVVITHSHADAIGGLDDLRDWTNNVQPHIPIYTAIRDLEVMKKTHYYLVDTSVIIPGAAVSELEFKVIHEDQPFVVND
LKITPLPVWHGSNYRSLGFRFGNVCYISDVSDIPEETYPLLKDCDLLIMDALRPDRSSATHFGLPRALEEVRKIKPKRTL
FTGMMHLMDHEKVSEELEKLRNTEGLDVQLSYDGLRVPISI*

DNA
ATGGCGGCTATGTCAGCGGTTCTGTCTCTGGGTTTAGGAACACTCCGCCCTTCGCATCGTTCCTTGTCCTGTTTCGATTC
CCTCCGGCACCACCAGACATCTTTTCTCCGTTGCCACCAAAGTCTCATCTCTAGAAATACGACGAGGTCTCCGCTCAACA
AGATTCTTCAGGCTTGCCTTCAATCCAATTCTGCAAATGGTGATGCTTTGGTGTCATCATCCGATGAAAGTTCTGAGATT
GTATTTATGGGTACCGGAACCAGTGAAGGGATTCCTCGTGTCAGCTGCCTCACTAATCCTTTGAAAACATGTTCGGTATG
CACAAAAGCAACAGAACCAGGAAACAGAAATAGGAGACTTAACACCAGCATTCTTGTTCGGTACATTAGACCATCCGGAA
CAAGTAACATCCTCATTGATTGTGGCAAGTTCTTCTACCATAGTGCCCTTCGATGGTTTCCCACCTTCGGGCTAAGAACA
CTTGATGCAGTTGTAATTACTCATTCTCATGCTGACGCAATTGGAGGTCTTGATGATCTTCGTGATTGGACAAACAATGT
CCAACCTCACATTCCAATTTACACTGCTATACGTGATCTCGAGGTGATGAAGAAGACCCATTATTACTTGGTTGATACAA
GTGTCATCATACCCGGAGCTGCAGTCTCAGAGTTGGAGTTTAAAGTCATACACGAGGACCAGCCATTTGTGGTAAACGAT
CTGAAGATCACCCCATTACCTGTATGGCATGGAAGTAACTACCGTTCCCTTGGTTTCCGCTTTGGTAATGTCTGCTACAT
AAGCGATGTCAGTGACATACCGGAAGAAACCTACCCGCTCCTTAAAGACTGTGATCTCCTAATTATGGATGCTTTGAGGC
CTGACCGGTCTTCAGCAACACACTTTGGCCTCCCAAGGGCGTTAGAGGAAGTTCGGAAAATCAAACCAAAAAGAACCCTT
TTCACCGGAATGATGCATTTGATGGACCACGAGAAGGTGAGCGAAGAACTGGAGAAACTTAGGAACACAGAAGGCCTCGA
TGTCCAACTGAGCTACGATGGTCTTCGTGTACCAATCTCAATTTAA