Details for Arabidopsis Locus AT3G13740

Position : Chr3 ( 5`- 4504270 .. 4506311 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13740

Protein [Map View]
MVILSASSTVRAALDTQPRLPYNPNAPRKVKKIPNGNSFLPPPSPAPSPGISISVADLLKRPSSKEITVDVDDTYMGYET
WSPSPPKLEKPRSVFNPASLAFIGDSIYELYARRHFLFPPLSIEDYNDRVRAVVRCEAQYALLNKLVDDDFLTKEERDIL
RWGKNLGSARTRTRRRAGNAVYNKASSLETLIGYLYLTNGKRLEKIMEKLGFSSDSSTEIVIEETNPKPSESSNLPNFIL
NEQVVSF*

DNA
ATGGTGATTTTATCGGCGAGCTCCACTGTGAGAGCTGCCTTAGATACACAACCTAGACTTCCCTACAACCCTAATGCGCC
GCGAAAAGTTAAGAAAATCCCTAACGGTAATTCATTCTTACCGCCGCCGTCACCTGCACCGTCTCCAGGAATCAGCATCT
CCGTCGCCGATTTGCTCAAGCGTCCTTCAAGTAAAGAGATAACTGTTGACGTTGATGATACTTATATGGGATATGAGACA
TGGTCTCCAAGTCCACCAAAGTTGGAGAAACCAAGATCAGTCTTCAATCCTGCTTCTTTAGCCTTTATAGGCGATTCCAT
TTATGAGCTATATGCTCGTAGGCATTTTCTTTTCCCTCCGCTTAGTATTGAAGATTATAACGATCGTGTTAGAGCTGTGG
TGCGCTGTGAAGCTCAGTATGCTTTGCTGAATAAACTTGTTGATGATGACTTTCTAACAAAGGAAGAGAGGGATATTCTT
AGGTGGGGAAAGAATCTAGGTTCTGCTAGAACACGTACAAGAAGGCGTGCAGGTAATGCGGTTTATAACAAGGCATCATC
ATTGGAAACACTAATTGGTTATCTGTATCTGACAAACGGGAAAAGATTAGAAAAAATAATGGAGAAGCTAGGATTCTCAA
GTGATTCTTCAACTGAGATCGTGATTGAAGAAACCAACCCTAAACCATCAGAATCATCCAACCTGCCAAACTTCATACTC
AACGAGCAAGTGGTGTCATTTTAG