Details for Arabidopsis Locus AT3G13730

Position : Chr3 ( 5`- 4497976 .. 4500920 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13730

Protein [Map View]
MDTSSSLLFFSFFFFIIIVIFNKINGLRSSPASKKKLNDHHVTSQSHGPKFPHGSLGWPVIGETIEFVSSAYSDRPESFM
DKRRLMYGRVFKSHIFGTATIVSTDAEVNRAVLQSDSTAFVPFYPKTVRELMGKSSILLINGSLHRRFHGLVGSFLKSPL
LKAQIVRDMHKFLSESMDLWSEDQPVLLQDVSKTVAFKVLAKALISVEKGEDLEELKREFENFISGLMSLPINFPGTQLH
RSLQAKKNMVKQVERIIEGKIRKTKNKEEDDVIAKDVVDVLLKDSSEHLTHNLIANNMIDMMIPGHDSVPVLITLAVKFL
SDSPAALNLLTEENMKLKSLKELTGEPLYWNDYLSLPFTQKVITETLRMGNVIIGVMRKAMKDVEIKGYVIPKGWCFLAY
LRSVHLDKLYYESPYKFNPWRWQERDMNTSSFSPFGGGQRLCPGLDLARLETSVFLHHLVTRFRWIAEEDTIINFPTVHM
KNKLPIWIKRI*

DNA
ATGGACACTTCTTCTTCACTTTTGTTCTTCTCCTTCTTCTTCTTTATCATCATCGTCATCTTCAACAAGATCAACGGTCT
CAGATCATCCCCAGCTTCAAAGAAAAAACTTAATGATCATCATGTTACATCCCAGAGTCACGGACCAAAGTTTCCACACG
GAAGCTTGGGATGGCCCGTCATCGGTGAAACCATCGAGTTCGTCTCTTCTGCTTACTCAGACCGTCCTGAGAGTTTCATG
GACAAGCGTCGTCTCATGTATGGGAGAGTGTTTAAGTCGCATATTTTTGGAACGGCGACGATCGTGTCGACGGATGCTGA
AGTGAACAGAGCCGTTTTACAGAGCGACTCGACAGCTTTCGTGCCGTTTTACCCAAAAACGGTAAGGGAGCTAATGGGAA
AATCGTCGATACTTCTTATCAACGGGAGTTTACATAGACGGTTCCATGGATTAGTCGGTTCTTTCTTAAAGTCGCCACTT
CTCAAAGCTCAAATCGTTAGAGACATGCACAAGTTTTTGTCGGAATCCATGGATCTATGGTCCGAGGACCAACCTGTGCT
CCTCCAAGACGTCTCCAAGACTGTTGCATTCAAAGTACTTGCCAAGGCATTGATAAGTGTAGAGAAAGGAGAAGATTTAG
AAGAGCTAAAGAGAGAGTTTGAAAATTTCATATCAGGACTCATGTCATTACCAATTAACTTCCCTGGAACGCAACTCCAT
AGATCTCTCCAAGCTAAGAAGAATATGGTGAAGCAAGTTGAAAGAATCATAGAAGGCAAAATTAGGAAAACAAAGAACAA
GGAGGAAGATGATGTTATTGCAAAGGATGTTGTGGATGTGTTGCTTAAGGACTCAAGTGAACATTTAACTCACAATTTGA
TTGCTAACAATATGATCGACATGATGATCCCTGGCCACGATTCTGTCCCTGTCCTCATTACCCTTGCCGTCAAATTCCTC
TCTGATTCTCCTGCTGCCCTCAATCTCCTAACGGAAGAAAACATGAAGCTGAAAAGTTTGAAGGAATTGACAGGAGAGCC
ACTATATTGGAATGACTACTTGTCGTTACCTTTTACACAAAAGGTGATTACAGAGACACTGAGAATGGGAAATGTTATAA
TTGGAGTGATGAGAAAGGCGATGAAAGATGTTGAAATAAAAGGATATGTGATACCAAAAGGATGGTGTTTCTTGGCCTAT
CTCAGATCAGTTCATCTTGATAAGCTTTATTATGAGTCTCCCTACAAATTTAATCCCTGGAGATGGCAAGAAAGGGACAT
GAACACGAGTAGTTTCAGTCCTTTTGGAGGTGGTCAGAGATTGTGCCCTGGTCTCGATTTGGCTCGTCTTGAAACTTCAG
TTTTTCTTCACCATCTTGTCACTCGCTTCAGATGGATAGCAGAAGAAGACACAATCATAAACTTCCCAACGGTGCATATG
AAGAACAAATTACCCATTTGGATCAAAAGAATATAA