Details for Arabidopsis Locus AT3G13677

Position : Chr3 ( 5`- 4476068 .. 4477092 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13677

Protein [Map View]
MGSRGNRVGERWNEMDCDEKSSVIQEEIKRVCKLPSNSVYAVHRLKVLNKINDLLSVQNIVSREGVGIAIHTALLLRIIY
HSLWDEFPLGRNIFPDSDTRMMKTHKSLKLEVNGTFREEVRRPLIVRNGVVYWSCIQRSYVLKCERWEQSKLSYKRGMGG
IVLGANVGEGL*

DNA
ATGGGAAGCAGAGGTAATCGTGTGGGAGAAAGATGGAATGAGATGGATTGTGATGAGAAATCGAGTGTGATTCAGGAAGA
GATCAAAAGGGTTTGTAAACTTCCATCAAACAGTGTTTATGCAGTTCATCGTCTCAAGGTTCTCAACAAAATCAACGACC
TTTTATCTGTCCAAAACATTGTCTCAAGAGAAGGAGTTGGAATTGCTATTCACACAGCTCTCCTTTTGAGAATAATATAC
CACAGTTTGTGGGATGAGTTTCCTTTAGGCCGTAACATATTTCCCGATAGTGACACTCGGATGATGAAAACCCACAAGTC
GCTCAAATTGGAAGTAAATGGCACATTCAGAGAAGAAGTGAGACGCCCATTAATCGTTAGGAATGGAGTTGTATATTGGT
CTTGCATTCAAAGAAGCTATGTTTTGAAGTGCGAGAGATGGGAGCAATCCAAGCTAAGCTATAAGCGTGGCATGGGTGGA
ATTGTCCTTGGCGCGAATGTGGGAGAAGGTTTGTGA