Details for Arabidopsis Locus AT3G13674

Position : Chr3 ( 5`- 4474777 .. 4475908 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13674

Protein [Map View]
MASSRVLGRFSSRLKSLCQNLSNKNANVSSLPSPIKSASPSSATSCRLNRSSRLPVELSSMIPLHSAIASSRLVSSLSVE
SKIWGLVPQGLSLPL*

DNA
ATGGCATCTTCAAGAGTGTTAGGCAGATTCTCGTCTCGATTAAAGTCTCTATGTCAAAATCTCAGCAACAAGAATGCCAA
TGTTTCATCACTCCCCTCTCCCATCAAATCTGCATCACCTTCCTCAGCAACTAGTTGTCGTCTCAATCGATCTTCAAGAT
TACCAGTGGAGTTGAGCTCGATGATACCTCTGCACAGTGCTATAGCATCGTCCAGGCTCGTCTCAAGTTTGTCCGTTGAA
TCCAAAATCTGGGGATTAGTTCCTCAAGGTCTTTCATTGCCTTTATGA