Details for Arabidopsis Locus AT3G13670

Position : Chr3 ( 5`- 4469222 .. 4473547 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13670

Protein [Map View]
MPELRRGVRRGRVTDAVAPNQLPQTPTEKKPKKSTVKAPKPVAGGVTGVAERPRTRLAARKLKEEDKEIPQEIPVVVPSK
DSDIDKNKGKEVVVEEEKKDMAIGNDSGGSNKAAAQEEEGNTAPFPERVQVGGSPLYKVERKLGKGGFGQVFVGRRISGG
NDRSAGASILEVALKFEHRSSKGCNYGPPHEWQVYNTLGGSHGVPRVHFKGRQGDYYVMVMDMLGPSLWDLWNTSGQAMS
SEMVACIAVESLSILEKMHAKGYVHGDVKPENFLLGQPSTSQEKKLFLVDLGLATKWREGGSGQHVEYDQRPDMFRGTVR
YASAHAHLGRTASRRDDLESLAYTLIFLHRGRLPWQGYQGDNKSFLVCKKKMATSPDMLCCFCPPPFKQFLEIVVNMKFD
EEPNYGKLVSLFQDLLGENPAIRPINTEGAQKIIFQVGQKRGRLSIGEEEEDAPRKKVRLGVPATQWISIYNARQPMKQR
YHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTHQVYELSPVFLHKEWIMEQWEKNYYISSIAGASNG
SSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDG
GFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTVS*

DNA
ATGCCGGAGCTTCGCCGTGGAGTCCGCCGTGGCCGTGTTACTGATGCTGTAGCTCCCAATCAGCTTCCGCAAACACCTAC
AGAAAAGAAACCGAAGAAGAGTACCGTTAAAGCTCCAAAACCGGTTGCCGGCGGAGTTACAGGAGTTGCAGAGAGGCCGA
GGACTAGATTAGCGGCGAGGAAATTAAAGGAGGAAGATAAAGAGATACCTCAGGAGATTCCGGTTGTTGTGCCGTCTAAG
GATAGCGATATCGATAAAAACAAGGGTAAAGAGGTAGTCGTTGAAGAAGAGAAGAAAGATATGGCTATTGGTAATGATAG
TGGTGGCTCTAACAAGGCGGCTGCTCAGGAAGAAGAAGGAAATACTGCTCCTTTCCCTGAGAGGGTTCAAGTTGGAGGAT
CACCACTATATAAAGTTGAGAGAAAGCTGGGGAAGGGTGGTTTTGGACAAGTATTTGTCGGACGTCGTATTAGTGGCGGT
AATGATCGTAGTGCAGGAGCTAGCATCTTGGAGGTTGCTCTAAAGTTTGAGCATAGGAGCAGCAAGGGTTGCAACTATGG
TCCTCCACATGAGTGGCAGGTTTACAACACCTTGGGTGGTAGCCATGGAGTCCCTAGAGTACATTTCAAAGGCAGGCAAG
GAGACTATTATGTCATGGTTATGGACATGCTTGGGCCTAGCTTATGGGATTTATGGAATACTTCAGGGCAAGCAATGTCC
TCGGAAATGGTAGCTTGCATTGCGGTTGAATCACTTTCCATCCTTGAAAAGATGCATGCAAAAGGTTATGTGCATGGGGA
TGTTAAGCCAGAAAATTTCTTACTCGGCCAGCCTTCAACGTCTCAAGAGAAAAAACTGTTTCTTGTTGATTTGGGACTAG
CTACAAAGTGGAGAGAAGGTGGTAGCGGACAACATGTTGAATATGATCAACGTCCTGATATGTTTAGAGGGACAGTTAGA
TACGCAAGTGCACATGCTCATTTAGGGAGAACTGCTAGCAGAAGGGATGATCTGGAATCATTAGCATATACACTGATCTT
TCTTCACCGAGGTAGATTGCCATGGCAAGGATATCAGGGAGATAACAAGTCATTCCTTGTTTGCAAAAAGAAGATGGCAA
CATCGCCGGATATGCTTTGTTGTTTTTGTCCCCCTCCTTTCAAACAATTTCTTGAGATCGTGGTAAATATGAAATTTGAT
GAAGAACCCAACTATGGAAAGTTAGTATCTCTGTTTCAAGACCTCTTGGGCGAAAATCCGGCAATTAGGCCTATAAACAC
AGAGGGTGCTCAAAAGATCATATTCCAAGTTGGCCAGAAGCGAGGTAGGTTGAGCATTGGGGAGGAAGAAGAAGATGCCC
CTAGGAAAAAGGTCCGTCTAGGAGTCCCTGCAACGCAATGGATATCGATTTACAATGCCAGGCAACCAATGAAGCAGAGG
TATCATTATAATGTGGCTGATATAAGACTGGCACAGCATATTGAGAGAGGTATTGCAGATGGTTTGTTGATAAGCTGTGT
ATCATCATGTTCGAATCTCTGGGCATTGATAATGGATGCTGGAACTGGCTTCACGCACCAAGTCTATGAACTCTCTCCTG
TATTCTTGCACAAGGAATGGATTATGGAGCAGTGGGAGAAGAACTACTACATTAGTTCTATTGCTGGTGCAAGCAATGGA
AGCTCCTTAGTTGTCATGTCAAAAGGTACGCAGTATACACAGCAGTCTTACAAAGTAAGCGATTCATTCCCGTTCAAGTG
GATAAACAAGAAATGGAGAGAAGGCTTCCATGTAACCTCAATGGCAACAGCTGGAAATCGATGGGGTGTTGTTATGTCCC
GCAATTCTGGCTACAGTGAACAGGTTGTGGAACTTGATTTTCTGTATCCAAGTGAAGGCATCCACAGGCGTTGGGATGGT
GGATTCAGAATCACATCAACAGCAGCCACAACCGATCAAGCTGCTCTCATCCTAAGCATCCCACGTCGTAGACTTGTTGA
TGAGACACAAGAGACGTTACGTACCTCTCAATTCCCCAGCACACACGTCAAGGAAAAATGGGGAAAGAATCTCTACCTTG
CATCGTTAAGCTATGGCCGAACTGTATCTTGA