Details for Arabidopsis Locus AT3G13580

Position : Chr3 ( 5`- 4433047 .. 4435305 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13580

Protein [Map View]
MTEAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKERELIQLKREAKLKGGFYVD
PEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLNH
QRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGMKKKRNHYVEGGDAGNRENFINELV
RRMN*

DNA
ATGACTGAAGCAGAGTCCAAGACTGTTGTTCCTGAGTCAGTGTTGAAGAAGAGAAAGAGGGAGGAAGAATGGGCACTTGC
CAAGAAACAGGAGCTTGAGGCTGCCAAAAAGCAGAATGCTGAGAAGAGGAAACTCATATTTAACCGGGCTAAACAGTACT
CCAAGGAGTACCAGGAGAAAGAAAGGGAATTAATCCAGCTGAAGCGTGAGGCAAAATTGAAAGGAGGCTTTTATGTTGAC
CCAGAAGCTAAACTGCTTTTCATTATCCGTATCCGTGGTATCAATGCCATTGACCCAAAGACAAAGAAGATTTTGCAACT
TTTGCGTTTAAGACAGATTTTCAATGGTGTGTTCTTGAAGGTCAACAAGGCAACCATTAACATGCTTCGCCGTGTTGAAC
CCTATGTAACCTATGGATACCCGAACTTAAAAAGTGTGAAGGAATTGATTTACAAACGAGGTTTTGGAAAGCTTAACCAC
CAGAGGACTGCCTTAACAGACAATTCTATTGTAGATCAGGGGCTAGGAAAGCATGGCATCATCTGCGTTGAGGATCTGAT
CCATGAGATCATGACGGTTGGGCCACATTTCAAGGAAGCCAATAACTTTTTGTGGCCATTCCAGTTGAAGGCTCCATTGG
GAGGGATGAAGAAGAAGAGGAACCATTACGTGGAAGGAGGAGATGCTGGAAACCGCGAGAACTTCATCAACGAGCTCGTT
AGGAGAATGAACTGA