Details for Arabidopsis Locus AT3G13570

Position : Chr3 ( 5`- 4429298 .. 4432159 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13570

Protein [Map View]
MRGRSYTPSPPRGYGRRGRSPSPRGRFGGSRDSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGF
GFIQFMDPADAAEAKHQMDGYLLLGRELTVVFAEENRKKPTEMRTRDRGGRSNRFQDRRRSPPRYSRSPPPRRGRRSRSR
SRGYNSPPAKRHQSRSVSPQDRRYEKERSYSRSPPHNGSRVRSGSPGRVKSHSRSPRRSVSPRKNRSYTPEQARSQSPVP
RQSRSPTPVPRGAQNGDRSPSQ*

DNA
ATGAGAGGAAGGAGCTACACGCCATCACCACCAAGGGGTTATGGAAGGAGGGGCCGGAGCCCTAGCCCTCGGGGCCGGTT
TGGTGGGAGTCGTGACAGTGATCTCCCAACCAGTCTCTTGGTTCGCAACTTACGTCATGATTGCAGGCAAGAAGACCTCA
GGAGGCCATTTGAGCAGTTTGGTCCCGTCAAGGACATCTACCTTCCTAGGGATTACTATACTGGAGATCCAAGGGGGTTT
GGATTCATTCAGTTTATGGATCCTGCTGATGCTGCTGAGGCTAAACATCAAATGGATGGTTATCTTCTTCTTGGTCGTGA
GTTGACTGTCGTATTTGCTGAAGAAAACCGGAAGAAGCCAACTGAGATGAGAACAAGGGATCGAGGTGGAAGGAGCAACA
GATTCCAGGACAGAAGACGTTCTCCTCCTCGGTACTCTCGGTCTCCTCCTCCTCGCCGTGGTCGTAGATCACGATCACGT
AGCCGCGGCTATAATTCTCCTCCCGCTAAAAGACATCAATCTAGGTCTGTCTCACCTCAGGATAGACGATATGAGAAGGA
GAGGTCATACTCTCGCTCACCACCCCATAATGGCTCAAGGGTTCGCAGTGGAAGTCCTGGGAGAGTGAAGAGCCACAGCA
GAAGCCCAAGAAGAAGCGTGAGCCCAAGAAAAAACAGGAGCTACACGCCAGAACAAGCAAGGAGCCAAAGCCCTGTCCCT
AGGCAGAGCAGGAGCCCGACCCCAGTCCCTCGTGGAGCACAAAATGGAGACCGTTCTCCAAGCCAGTGA