Details for Arabidopsis Locus AT3G13550

Position : Chr3 ( 5`- 4423349 .. 4424883 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13550

Protein [Map View]
MMTPGGSGRLRPLPTAMYAGYSGTASSWVAKTSVSASGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPY
EGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIAR
LYLTDREKHDEVAKEWTLRFAK*

DNA
ATGATGACACCTGGCGGAAGCGGGAGGTTGAGACCGTTACCGACGGCGATGTACGCCGGATATTCAGGAACGGCGTCGTC
TTGGGTAGCGAAGACTTCAGTTTCTGCGTCAGGGAAGAGGATACAGAGGGAGATGGCTGAGCTTAACATTGATCCACCTC
CTGATTGCTCAGCTGGTCCAAAAGGAGATAATCTCTACCATTGGATCGCCACCATCATTGGTCCTTCGGGAACTCCCTAT
GAAGGAGGGATCTTTTTCCTGGATATAATTTTCCCATCTGATTATCCATTCAAGCCACCTAAGTTGGTGTTCAAGACTCG
GATTTACCATTGCAATGTTGATACTGCGGGAGATTTAAGTGTGAACATTCTAAGAGATAGTTGGAGTCCAGCCCTTACAA
TCACTAAAGTCTTACAAGCCATCAGATCTATCTTCTTAAAACCTGAACCCTATAGTCCAGCTTTACCGGTGATTGCACGG
CTCTACTTGACAGATAGAGAAAAGCATGACGAGGTAGCCAAAGAATGGACATTGCGATTTGCCAAGTGA