Details for Arabidopsis Locus AT3G13540

Position : Chr3 ( 5`- 4420173 .. 4421701 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13540

Protein [Map View]
MMSCGGKKPVSKKTTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGG
ITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHKPLDANNIHKPEEEVSGGQKYPL
EPISSSHTDDTTVNGGDGDSKNSINVFGGEHGYEDFGFCYDDKFSSFLNSLINDVGDPFGNIIPISQPLQMDDCKDGIVG
ASSSSLGHD*

DNA
ATGATGTCATGTGGTGGGAAGAAGCCAGTGTCTAAGAAAACAACGCCGTGTTGCACGAAGATGGGGATGAAGAGAGGACC
ATGGACGGTGGAGGAAGACGAGATTCTTGTGAGCTTCATTAAGAAAGAAGGTGAAGGACGGTGGCGATCGCTTCCTAAGA
GAGCTGGTTTACTCAGATGTGGAAAGAGCTGTCGTCTACGGTGGATGAACTATCTCCGACCCTCGGTTAAACGTGGAGGA
ATTACGTCGGACGAGGAAGATCTCATCCTCCGTCTTCACCGCCTCCTCGGCAACAGGTGGTCATTGATCGCGGGAAGGAT
ACCGGGAAGGACTGATAATGAAATTAAGAACTATTGGAACACTCATCTTCGTAAGAAACTTTTAAGGCAAGGAATTGATC
CTCAAACCCACAAGCCTCTTGATGCAAACAACATCCATAAACCAGAAGAAGAAGTTTCCGGTGGACAAAAGTACCCTCTA
GAGCCTATTTCTAGTTCTCATACTGATGATACCACTGTTAATGGCGGGGATGGAGATAGCAAGAACAGTATCAATGTCTT
TGGTGGTGAACACGGCTACGAAGACTTTGGTTTCTGCTACGACGACAAGTTCTCATCGTTTCTTAATTCGCTCATCAACG
ATGTTGGTGATCCTTTTGGTAATATTATCCCAATATCTCAACCTTTGCAGATGGATGATTGTAAGGATGGGATTGTTGGA
GCGTCGTCTTCTAGCTTAGGACATGACTAG