Details for Arabidopsis Locus AT3G13530

Position : Chr3 ( 5`- 4411688 .. 4419320 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13530

Protein [Map View]
MARQMTSSQFHKSKTLDNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLNTIMQEIDLLKNLNHKNIV
KYLGSSKTKTHLHIILEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKL
ADFGVATKLNEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDDNPPIP
DSLSPDITDFLRQCFKKDSRQRPDAKTLLSHPWIRNSRRALQSSLRHSGTIKYMKEATASSEKDDEGSQDAAESLSGENV
GISKTDSKSKLPLVGVSSFRSEKDQSTPSDLGEEGTDNSEDDIMSDQVPTLSIHEKSSDAKGTPQDVSDFHGKSERGETP
ENLVTETSEARKNTSAIKHVGKELSIPVDQTSHSFGRKGEERGIRKAVKTPSSVSGNELARFSDPPGDASLHDLFHPLDK
VSEGKPNEASTSMPTSNVNQGDSPVADGGKNDLATKLRATIAQKQMEGETGHSNDGGDLFRLMMGVLKDDVIDIDGLVFD
EKVPAENLFPLQAVEFSRLVSSLRPDESEDAIVSSCQKLVAMFRQRPEQKVVFVTQHGFLPLMDLLDIPKSRVICAVLQL
INEIIKDNTDFQENACLVGLIPVVMSFAGPERDRSREIRKEAAYFLQQLCQSSPLTLQMFIACRGIPVLVGFLEADYAKY
REMVHLAIDGMWQVFKLKRSTPRNDFCRIAAKNGILLRLINTLYSLNEATRLASISGGLDGQAPRVRSGQLDPNNPIFGQ
NETSSLSMIDQPDVLKTRHGGGEEPSHASTSNSQRSDVHQPDALHPDGDKPRVSSVAPDASTSGTEDVRQQHRISLSANR
TSTDKLQKLAEGASNGFPVTQTEQVRPLLSLLDKEPPSRHYSGQLDYVKHITGIERHESRLPLLHGSNEKKNNGDLDFLM
AEFAEVSGRGKENGSLDTTTRYPSKTMTKKVLAIEGVASTSGIASQTASGVLSGSGVLNARPGSATSSGLLAHMVSTLSA
DVAREYLEKVADLLLEFARADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILECTNHLSTDPNCLENLQRADAIKHLIP
NLELKDGHLVYQIHHEVLSALFNLCKINKRRQEQAAENGIIPHLMLFIMSDSPLKQYALPLLCDMAHASRNSREQLRAHG
GLDVYLSLLDDEYWSVIALDSIAVCLAQDNDNRKVEQALLKQDAIQKLVDFFQSCPERHFVHILEPFLKIITKSYRINKT
LAVNGLTPLLISRLDHQDAIARLNLLKLIKAVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRSGGQVLVKQMATSLLK
ALHINTIL*

DNA
ATGGCGCGGCAAATGACGTCATCTCAGTTTCACAAATCAAAGACTCTCGACAACAAATATATGCTGGGAGATGAAATTGG
TAAAGGAGCTTATGGTCGAGTTTATAAAGGATTAGACTTGGAGAATGGTGACTTTGTGGCCATTAAACAAGTCTCTTTGG
AAAATATTGTTCAAGAGGATCTTAACACCATTATGCAAGAAATTGATCTTTTGAAGAACTTGAACCATAAAAACATTGTG
AAGTATCTTGGGTCGTCGAAGACAAAGACTCACCTTCACATTATTTTGGAGTACGTTGAGAATGGCTCTCTTGCAAACAT
TATTAAACCAAATAAATTTGGACCTTTCCCAGAATCTTTGGTGGCTGTTTACATTGCTCAGGTCTTGGAAGGTTTGGTAT
ATCTGCATGAGCAGGGTGTTATACACCGTGATATTAAGGGTGCAAATATTTTGACGACAAAGGAGGGTCTTGTGAAGCTT
GCTGACTTTGGAGTTGCCACTAAACTTAACGAGGCTGATGTTAATACTCACTCGGTGGTTGGAACTCCTTACTGGATGGC
TCCTGAGGTTATTGAAATGTCAGGAGTTTGTGCTGCTTCTGACATTTGGAGCGTTGGATGCACTGTTATCGAACTTCTGA
CATGTGTACCTCCTTACTATGATCTGCAACCCATGCCAGCCCTCTTTCGTATTGTTCAGGATGACAACCCTCCTATTCCT
GATAGTCTTTCTCCAGATATTACGGACTTTCTACGACAGTGCTTCAAGAAGGATTCCAGGCAGAGGCCTGATGCAAAGAC
ACTGCTCTCTCACCCTTGGATACGAAACTCTAGACGAGCTTTGCAGTCATCACTTCGGCATAGTGGCACCATCAAATATA
TGAAGGAAGCCACTGCAAGTTCAGAGAAGGATGATGAAGGTAGTCAAGATGCAGCAGAAAGCCTTTCAGGAGAAAATGTG
GGAATATCAAAAACTGACTCGAAAAGCAAATTACCTCTGGTAGGGGTGTCGAGTTTTAGGTCTGAGAAAGATCAGTCGAC
ACCCAGTGATCTTGGTGAAGAAGGAACAGATAATTCAGAAGATGATATTATGTCAGATCAAGTTCCTACACTGTCGATCC
ATGAGAAATCTTCGGATGCTAAGGGGACACCTCAAGATGTATCAGACTTTCATGGGAAATCTGAACGTGGTGAAACACCT
GAAAATCTTGTAACGGAAACTTCTGAAGCTAGAAAAAATACTTCAGCAATAAAGCACGTTGGCAAAGAATTATCCATCCC
AGTGGACCAGACATCACATAGTTTTGGCCGCAAAGGTGAAGAACGTGGGATTCGAAAGGCTGTGAAGACTCCATCTAGTG
TTAGTGGGAATGAACTGGCTAGGTTTAGTGATCCTCCTGGGGATGCTTCTTTGCATGATTTATTTCACCCATTGGATAAA
GTGTCTGAGGGAAAACCAAATGAAGCCTCAACATCCATGCCTACGTCAAATGTCAACCAAGGTGATTCTCCTGTTGCAGA
TGGTGGAAAGAATGATCTGGCTACAAAATTGAGGGCTACAATTGCTCAGAAGCAAATGGAGGGGGAAACAGGGCACTCAA
ATGATGGTGGTGATCTTTTTCGCTTGATGATGGGTGTTTTGAAAGATGATGTTATTGACATTGATGGCTTGGTATTTGAT
GAAAAAGTGCCCGCGGAGAATCTTTTTCCTCTGCAGGCAGTCGAGTTCAGCAGACTGGTCAGCTCCTTGAGGCCAGATGA
GTCAGAAGATGCAATAGTATCTTCTTGTCAGAAACTTGTTGCCATGTTTCGTCAGAGACCTGAGCAGAAAGTAGTATTTG
TGACACAGCATGGTTTCCTGCCTCTAATGGATCTACTCGATATTCCTAAATCTCGAGTAATATGTGCTGTGCTGCAGCTG
ATAAACGAAATTATTAAAGATAACACTGACTTCCAGGAAAATGCTTGTCTTGTTGGCCTTATTCCTGTTGTAATGAGTTT
TGCTGGTCCTGAGAGGGATCGTTCTCGCGAAATTCGTAAAGAAGCAGCTTACTTCTTGCAGCAGCTTTGTCAGTCAAGCC
CCTTGACGTTGCAAATGTTCATAGCTTGCCGTGGAATACCCGTTTTGGTGGGATTTCTTGAAGCAGATTATGCCAAATAC
AGGGAGATGGTTCACTTGGCTATTGATGGGATGTGGCAGGTATTTAAACTCAAAAGATCCACCCCAAGAAATGATTTCTG
CCGTATAGCTGCAAAGAATGGAATTCTTCTGAGGCTAATCAACACTCTTTATAGCTTGAATGAGGCAACCCGGCTGGCTT
CTATATCAGGGGGCCTGGATGGTCAAGCTCCACGAGTGCGCTCTGGTCAACTTGACCCTAACAATCCTATTTTTGGTCAA
AATGAGACTTCTTCACTCAGTATGATTGATCAGCCTGATGTATTGAAAACTAGGCATGGGGGTGGTGAAGAGCCTTCTCA
TGCTTCAACCTCAAATTCTCAAAGATCAGATGTCCATCAACCAGATGCTTTGCACCCAGATGGTGATAAGCCTAGAGTAA
GCAGTGTTGCACCAGATGCCTCAACCTCTGGCACAGAAGATGTTAGACAACAGCATCGAATATCTCTTTCCGCCAATAGG
ACATCGACAGATAAGCTTCAGAAGCTGGCAGAGGGCGCCTCTAATGGTTTTCCTGTTACTCAGACAGAACAAGTTCGACC
TTTGCTTAGCTTGTTGGATAAAGAACCCCCTTCAAGACATTATTCTGGTCAACTGGATTATGTTAAGCATATCACTGGCA
TAGAGAGACATGAAAGTAGACTTCCTCTTTTGCATGGATCAAATGAAAAGAAAAACAACGGAGACCTAGATTTTCTGATG
GCTGAATTTGCAGAGGTCTCTGGACGTGGAAAGGAAAATGGAAGTCTTGATACTACGACTAGATATCCCAGTAAAACAAT
GACAAAGAAGGTTCTGGCTATTGAAGGAGTTGCTTCAACATCTGGGATTGCATCTCAGACAGCATCTGGAGTACTGTCAG
GTTCGGGTGTTCTAAACGCTAGACCTGGAAGTGCCACATCATCTGGTTTACTTGCCCATATGGTCTCTACGCTGAGTGCA
GATGTTGCAAGGGAATACTTGGAGAAAGTTGCTGACCTGCTTCTTGAATTTGCTCGAGCTGATACGACAGTAAAGTCATA
TATGTGCAGCCAAAGCTTACTCAGTCGTCTTTTTCAGATGTTCAACCGTGTAGAACCTCCTATTCTGTTAAAGATACTGG
AGTGCACAAATCATTTATCAACTGATCCAAATTGCTTGGAGAATCTGCAGCGTGCAGATGCAATTAAGCATTTGATCCCC
AACCTTGAGCTTAAGGATGGGCATCTTGTTTATCAGATCCATCATGAGGTGCTTAGTGCACTATTCAACCTGTGCAAGAT
AAACAAGAGGAGGCAGGAACAAGCGGCTGAAAACGGAATCATTCCGCATCTGATGCTTTTCATTATGTCAGATTCTCCTC
TGAAACAGTATGCATTGCCACTACTCTGCGATATGGCTCATGCATCTCGAAATTCAAGAGAACAGTTAAGGGCCCACGGT
GGTCTTGATGTTTACCTGAGTTTACTCGATGATGAATACTGGTCCGTGATAGCCTTAGATTCAATCGCTGTTTGCTTGGC
GCAAGACAATGACAACCGCAAGGTAGAGCAGGCATTGCTCAAGCAAGATGCAATTCAGAAATTAGTTGACTTCTTCCAGA
GCTGCCCAGAGAGACACTTCGTGCACATATTGGAGCCATTCTTAAAGATTATCACGAAATCATATCGGATCAATAAGACA
TTAGCTGTAAATGGATTGACTCCACTGCTTATTTCAAGGCTAGACCATCAAGATGCGATTGCTCGACTTAACCTCCTAAA
ACTCATCAAGGCTGTTTATGAACATCATCCACGGCCGAAACAGCTGATCGTAGAGAACGACCTTCCTCAAAAACTGCAGA
ATCTAATAGAAGAACGACGAGATGGACAACGTTCAGGAGGCCAAGTTCTGGTGAAACAAATGGCAACATCTCTCCTCAAA
GCACTTCACATCAACACAATATTGTGA