Details for Arabidopsis Locus AT3G13520

Position : Chr3 ( 5`- 4408925 .. 4409440 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13520

Protein [Map View]
MESMKMKLIVVLMVAIVAFSAVGNVAAQTEAPAPSPTSDAAMFVPALFASVAALASGFLF*

DNA
ATGGAGTCAATGAAGATGAAGCTCATAGTGGTGTTGATGGTGGCTATTGTGGCTTTCTCCGCCGTAGGAAACGTGGCTGC
GCAGACAGAGGCTCCGGCTCCAAGTCCTACTTCCGATGCTGCTATGTTTGTCCCGGCATTGTTTGCATCTGTTGCTGCTT
TGGCATCAGGGTTTCTCTTCTAA