Details for Arabidopsis Locus AT3G13500

Position : Chr3 ( 5`- 4399974 .. 4400306 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13500

Protein [Map View]
MATVAKFSTDKWQRMRRVPSSELMNTQQLMEVACCLPLSHLFICLWEFLCFSVSDYDSDDDYDYVDDDDDDDDVDDDDVV
AFDHNSNGDFDDHGSSSLDFDDYYHYSDSD*

DNA
ATGGCGACGGTGGCGAAATTTTCCACCGACAAGTGGCAGCGGATGAGGAGGGTTCCGTCGTCGGAGTTGATGAATACGCA
ACAGCTTATGGAGGTGGCTTGTTGCCTCCCTCTTAGTCATCTCTTTATCTGTCTTTGGGAGTTTCTGTGTTTCTCCGTAT
CCGATTATGATTCTGATGATGATTATGATTATGTTGATGATGATGATGATGATGATGATGTTGATGATGACGATGTGGTT
GCTTTTGATCATAATAGTAACGGCGATTTTGATGATCATGGGTCTTCTTCCTTGGATTTTGATGACTATTACCATTACTC
GGACTCCGACTAA