Details for Arabidopsis Locus AT3G13480

Position : Chr3 ( 5`- 4392956 .. 4393961 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13480

Protein [Map View]
MIGCFKDPTYVLMRVLLCKIQCPSFICFCKPSPHIYASGSLKLENTFPQVSSSTTVVDDRDHDDNDDDDAHVEEEEVVVD
HVDGLLTEVVREEDCALEGKKEEEESLSNGEILKSSLKKEVLDSADGGRKEKKKVQWVDLMGKELAEIREFESSEEEDVR
YDGDQSCVCVIL*

DNA
ATGATCGGGTGTTTTAAAGACCCAACATATGTTTTGATGAGGGTTTTGCTGTGTAAGATCCAGTGCCCTTCTTTCATCTG
TTTCTGTAAGCCTTCTCCTCATATCTACGCTTCTGGTTCTCTCAAATTGGAGAATACTTTTCCTCAAGTGTCTTCTTCGA
CTACGGTTGTTGATGATCGTGACCATGATGACAATGATGATGATGATGCACATGTAGAAGAAGAAGAAGTTGTTGTTGAT
CATGTTGATGGTTTGTTGACTGAGGTTGTTAGAGAAGAAGATTGTGCTCTAGAGGGAAAAAAGGAAGAAGAAGAAAGTCT
TAGTAATGGGGAAATCTTGAAAAGCAGTCTCAAGAAGGAGGTCTTAGATTCAGCAGATGGTGGGAGAAAGGAGAAGAAGA
AAGTACAGTGGGTGGATTTGATGGGGAAAGAACTTGCTGAGATCCGAGAATTCGAGTCTAGTGAAGAAGAAGATGTTAGA
TATGATGGCGATCAAAGCTGTGTTTGTGTTATTCTGTGA