Details for Arabidopsis Locus AT3G13432

Position : Chr3 ( 5`- 4371470 .. 4371987 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13432

Protein [Map View]
MKVKFCLIASLLILSFAISSYVVSYKSKEETIAETIHIRKVMKIRVPRSKSPPDRQWGEGDSPQAASPNSV*

DNA
ATGAAGGTCAAGTTCTGTTTGATTGCTTCCCTTTTGATTCTCTCTTTCGCGATTTCGTCATACGTCGTCTCATACAAATC
CAAAGAAGAAACAATAGCAGAAACGATTCACATTCGAAAGGTAATGAAGATCAGAGTACCTCGTAGTAAGTCACCACCCG
ATCGCCAATGGGGTGAGGGTGACTCGCCACAAGCCGCAAGTCCAAATTCAGTATAA