Details for Arabidopsis Locus AT3G13420

Position : Chr3 ( 5`- 4364527 .. 4366791 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13420

Protein [Map View]
MLCVSLRNRIHNWLRDYVRLQSVVLILIYAQIGCALIGSLGALYNGVVLINLAIALFGLVAIESNSQSLGRTYAVLLFCA
ILLDVSWFILFSKEIWNISSDMYQVFYIFSVKLTLAMEIAGFVVRLSSSLLWFQIYRLGASIIDSPFPRQSDSDLRNSFL
EPPLLARQRSRDPELRNSFLQAPAIAKQRSRSDEILEDSIDEPASYTPLLDGGLSNITLPNATQVFLFLPILLLSCLCTH
CS*

DNA
ATGCTTTGTGTTTCGTTACGAAATCGAATACATAATTGGCTTCGCGACTACGTTAGGCTCCAATCTGTCGTTTTGATTCT
TATCTATGCTCAGATAGGGTGCGCGTTGATCGGTTCACTAGGGGCATTGTACAATGGAGTCGTGCTGATAAATTTGGCGA
TTGCGTTATTTGGGTTAGTAGCAATCGAGAGTAATAGCCAAAGTCTTGGCAGAACCTATGCGGTTCTTCTTTTCTGCGCC
ATTCTTCTTGATGTCTCATGGTTCATTCTCTTCTCCAAAGAGATTTGGAACATTTCATCTGATATGTATCAAGTCTTTTA
CATCTTCTCTGTGAAACTCACCCTGGCTATGGAAATTGCTGGGTTCGTTGTGAGGCTATCGTCCTCTCTGTTATGGTTTC
AGATCTATAGGCTGGGAGCTTCTATTATAGACTCTCCATTTCCCCGTCAATCAGATTCAGATTTACGGAATAGCTTCTTA
GAACCTCCTCTTTTAGCTAGGCAACGTTCACGTGATCCAGAATTACGAAATAGCTTCTTACAGGCTCCTGCTATAGCTAA
GCAACGTTCACGTTCTGACGAAATCTTGGAAGATTCTATTGACGAACCTGCCTCCTACACTCCTCTGTTAGATGGCGGCC
TAAGCAATATCACTTTGCCCAATGCAACACAGGTCTTTTTATTTCTACCTATTCTTCTCTTAAGTTGTTTGTGTACTCAT
TGTAGTTGA