Details for Arabidopsis Locus AT3G13410

Position : Chr3 ( 5`- 4361857 .. 4364262 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13410

Protein [Map View]
MKKIQIGAVALLVFLSVASLFEIGLASPNTVPAFLWSPHLQSANGELDEAVNYQVMSAKDLVGSVFTQGGWSNFLCSEKK
LEQPVDVALVFIGRELLSSDVSSKRNSDPALVNTLNNLFTASNFSLAFPYIAAPEEERMENLLLSGLKEACPNNVGVSNI
VFSDSCFVEDGTIQKLSDLQSFKDHLLARRETRKEGETDLVVLCSEGSESNSQAGQSHSERESFLELVSSVEQSGSKYTA
LYVSDPYWYTSYKTLQRFLAETAKGNSTPEIATGCDELCKFKSSLLEGILVGIVFLLILISGLCCMAGIDTPTRFETPQD
S*

DNA
ATGAAGAAGATTCAAATTGGTGCGGTGGCGCTATTGGTGTTTCTATCTGTGGCCTCTCTCTTTGAAATCGGATTGGCTTC
TCCGAACACAGTTCCTGCTTTCCTCTGGTCTCCGCATCTCCAGTCTGCTAATGGTGAATTGGATGAGGCTGTAAATTATC
AGGTCATGTCTGCAAAGGATCTAGTTGGTTCTGTTTTCACTCAAGGAGGTTGGTCAAACTTTCTGTGCTCAGAGAAGAAG
CTTGAGCAACCTGTTGATGTTGCACTTGTGTTCATAGGCAGAGAGTTACTGTCTTCTGATGTTTCTTCAAAAAGGAACTC
AGATCCTGCCCTTGTTAACACATTGAATAATCTATTTACAGCTTCCAACTTCTCATTGGCATTCCCATATATTGCTGCTC
CAGAGGAAGAAAGGATGGAGAATTTGTTACTTTCAGGGCTTAAAGAAGCTTGTCCCAACAATGTAGGAGTCAGCAATATC
GTGTTCTCAGATTCGTGCTTTGTTGAGGATGGAACAATTCAGAAACTTTCAGACTTGCAGTCTTTCAAAGATCATTTGCT
TGCTAGAAGAGAAACAAGGAAAGAAGGAGAAACTGACTTGGTTGTGCTCTGTTCCGAGGGTTCTGAATCGAATAGTCAAG
CTGGACAGTCACATTCAGAGCGTGAAAGCTTCTTGGAACTTGTTAGTTCTGTAGAACAATCCGGCAGTAAATATACAGCT
CTTTATGTTTCTGATCCTTATTGGTACACATCTTACAAAACTCTCCAAAGGTTTCTAGCTGAAACTGCTAAAGGAAACAG
TACTCCTGAAATTGCTACTGGCTGTGATGAACTCTGCAAATTTAAGTCATCACTTTTGGAGGGCATACTAGTGGGAATCG
TTTTTCTTCTCATCTTGATCAGTGGACTTTGCTGTATGGCGGGTATCGATACACCGACTAGATTCGAGACTCCTCAAGAT
TCTTAA