Details for Arabidopsis Locus AT3G13310

Position : Chr3 ( 5`- 4310608 .. 4311441 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13310

Protein [Map View]
MAGTLVNSAGRFSPGNCILPQQRTARFYSGTARFPTGAPSFKASAQTLNAEPAVTESVRRRVSSLYELLKVNETASLTEI
KTAYRSLAKVYHPDASESDGRDFMEIHKAYATLADPTTRAIYDSTLRVPRRRVHAGAMGRSGRVYATTRRWETDQCW*

DNA
ATGGCTGGAACCCTAGTTAACTCCGCCGGGAGATTCTCACCGGGAAATTGTATTCTTCCTCAACAGAGAACAGCCAGATT
CTACAGCGGAACCGCGAGATTTCCCACCGGAGCTCCGTCGTTTAAGGCTTCAGCTCAGACGCTTAACGCCGAGCCAGCTG
TAACGGAATCCGTTCGTCGGAGAGTTTCTAGCCTCTACGAATTACTGAAAGTGAATGAAACGGCGTCCTTGACGGAGATC
AAGACGGCGTACCGGAGCTTAGCTAAAGTATATCATCCAGATGCGTCGGAATCGGACGGTCGAGATTTTATGGAGATTCA
CAAAGCTTACGCGACACTTGCGGATCCGACTACAAGAGCGATTTACGACTCGACGCTTAGAGTACCACGGAGACGGGTAC
ACGCCGGAGCGATGGGTCGGTCGGGGCGGGTTTACGCTACGACCCGGAGATGGGAGACGGATCAGTGTTGGTGA