Details for Arabidopsis Locus AT3G13275

Position : Chr3 ( 5`- 4289194 .. 4289842 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13275

Protein [Map View]
MCCGRICMLCTCLLLVVIAIGFLFGFGVFKDGFHKIHESIHLECDPRFGCGGGLGRRGYGFPAPAGGFN*

DNA
ATGTGTTGTGGACGGATTTGCATGCTGTGCACGTGTTTGCTTCTTGTGGTGATCGCGATTGGGTTTCTATTTGGATTCGG
TGTCTTCAAGGATGGATTTCACAAGATCCATGAATCAATTCATCTCGAATGCGATCCCAGATTTGGTTGCGGCGGTGGCC
TTGGACGTCGCGGTTATGGTTTCCCAGCTCCGGCCGGTGGTTTTAATTAG