Details for Arabidopsis Locus AT3G13235

Position : Chr3 ( 5`- 4271212 .. 4274455 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13235

Protein [Map View]
MRITVMTAGEQIITLDVDSQETVENVKALLEVESNVPIQQQQLLYNGNEMGNSDKLSALGVKDDDLLMMMVSNASSGSAT
SAAGNDLGMNPDGSALNPAAFQQHIRGDSNLMGQLFQNDPELAQVISGSDLNKLQDVLRARHRQRSVLQRQKEEELALLY
ADPFDVEAQRKIEAAIRQKGIDENWEAALEHNPEGFARVIMLYVDMEVNGVPLKAFVDSGAQSTIISKSCAERCGLLRLM
DQRYKGIAHGVGQTEILGRIHVAPIKIGNNFYPCSFVVLDSPNMEFLFGLDMLRKHQCTIDLKENVMTVGGGEVSVPFLQ
EKDIPSRFLDEERVPNDASSSGATVPSGFTEKKNNTVANPTSQQPKRQNTSEGPEFEAKIAKLVELGFSRDSVIQALKLF
EGNEEQAAGFLFGG*

DNA
ATGAGGATCACTGTCATGACCGCCGGTGAACAAATCATCACTCTCGATGTCGATTCTCAGGAGACTGTTGAGAATGTTAA
AGCCTTGCTCGAGGTTGAGTCCAATGTTCCGATTCAGCAGCAGCAGCTGTTGTATAATGGAAACGAGATGGGAAATTCCG
ATAAATTGAGTGCCTTGGGTGTTAAGGATGATGATTTATTGATGATGATGGTTTCCAATGCCTCATCTGGTAGTGCCACT
AGTGCGGCGGGGAATGATTTGGGCATGAATCCTGATGGGTCAGCTTTGAACCCTGCAGCCTTTCAACAACACATTCGTGG
GGATTCTAATCTTATGGGACAGTTATTTCAGAATGATCCTGAGCTTGCACAAGTGATTTCTGGAAGCGATTTAAATAAGT
TACAGGATGTTTTGCGTGCACGGCATCGTCAGCGATCTGTTTTACAGCGTCAGAAGGAAGAGGAACTTGCCCTTCTGTAT
GCAGATCCTTTTGATGTTGAAGCACAGAGGAAAATTGAAGCTGCAATTCGTCAGAAAGGAATTGATGAGAACTGGGAAGC
TGCCCTTGAACATAATCCTGAAGGTTTTGCTCGGGTGATAATGCTCTATGTGGATATGGAGGTCAACGGCGTACCTTTGA
AGGCTTTCGTTGATAGTGGTGCACAGTCGACAATTATATCCAAGAGTTGTGCTGAGAGATGCGGATTGCTGAGACTTATG
GACCAACGCTACAAAGGTATTGCCCATGGTGTTGGCCAAACAGAGATATTGGGCCGCATTCATGTTGCTCCTATCAAGAT
TGGAAACAACTTTTACCCTTGTTCATTCGTGGTGCTGGACTCACCTAACATGGAATTTCTGTTTGGCCTGGATATGCTGC
GTAAGCATCAGTGCACTATAGATTTGAAGGAAAACGTCATGACTGTTGGAGGAGGAGAGGTCTCGGTTCCCTTTTTGCAA
GAGAAAGACATCCCGTCCCGATTTCTGGATGAAGAGCGTGTTCCAAATGATGCATCTAGCTCTGGAGCAACGGTTCCTTC
TGGGTTCACAGAGAAGAAGAATAACACTGTTGCAAACCCAACAAGCCAACAACCGAAAAGGCAGAACACATCAGAGGGAC
CTGAATTTGAAGCCAAGATTGCAAAGCTTGTGGAACTAGGGTTCTCCCGCGATTCAGTGATACAAGCTCTCAAATTGTTT
GAAGGAAACGAAGAACAAGCTGCTGGGTTTCTCTTTGGCGGCTAA