Details for Arabidopsis Locus AT3G13229

Position : Chr3 ( 5`- 4268444 .. 4269691 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13229

Protein [Map View]
MFNQSSSVSLIYVVEIAKTPQNVDVTWSKTTSSHSLTIKIENVKDEQQNHHQPVKIDLSGSSFWAKKGLKSLEANGTRVD
VYWDFRQAKFSNFPEPSSGFYVSLVSQNATVLTIGDLRNEALKRTKKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGES
RRENEVVIETSLSGPSDPEMWITVDGVPAIRIMNLNWRFRGNEVVTVSDGVSLEIFWDVHDWLFEPSGSSSGLFVFKPKA
GFESKCLSFNGGYGDGEGEDHDVEDDDSSPKYCHVLYAVKELEFPCQKN*

DNA
ATGTTTAATCAATCCAGCTCTGTCTCGTTAATCTACGTAGTTGAAATCGCCAAAACACCACAAAACGTAGACGTCACTTG
GTCTAAAACCACCTCCTCACATTCTTTAACCATCAAAATCGAGAACGTCAAAGACGAGCAACAGAATCATCATCAACCGG
TGAAGATAGATCTTTCAGGTTCTTCGTTTTGGGCCAAAAAGGGTCTCAAGAGCTTAGAAGCTAACGGAACTAGAGTCGAC
GTATACTGGGATTTTCGTCAAGCCAAATTCTCGAACTTCCCTGAACCTTCCTCTGGCTTCTACGTCTCTCTCGTATCCCA
AAACGCAACCGTTTTAACGATCGGGGATTTAAGGAACGAAGCTTTAAAGAGGACGAAGAAGAACCCTTCAGCTACAGAAG
CTGCCTTGGTCTCCAAGCAAGAACACGTCCACGGGAAACGCGTTTTCTACACGCGGACGGCGTTTGGCGGTGGGGAGTCG
AGGCGGGAGAATGAGGTGGTGATCGAAACATCTCTGTCGGGTCCTAGCGATCCAGAGATGTGGATCACGGTGGACGGTGT
GCCGGCGATTAGGATCATGAATTTGAATTGGAGATTTAGAGGGAATGAGGTTGTGACTGTGAGTGATGGTGTTTCTTTGG
AGATCTTTTGGGACGTTCATGATTGGCTGTTTGAACCCTCTGGTTCGTCTAGTGGGTTGTTTGTTTTCAAGCCTAAAGCT
GGATTTGAATCTAAATGTCTTAGTTTTAATGGTGGCTATGGTGATGGTGAAGGTGAGGATCATGATGTGGAAGATGACGA
TTCGTCGCCCAAGTATTGTCATGTCCTATATGCCGTCAAAGAACTAGAATTTCCATGTCAAAAAAATTAG