Details for Arabidopsis Locus AT3G13228

Position : Chr3 ( 5`- 4266964 .. 4268251 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13228

Protein [Map View]
MFTVLRVDFSHKIKDDPKPEEAGIIIVNAMIYRETDTLTLTTSSSADELISDDGNECQIKMDLINILKVAGLSDYDTAHM
MYHFIPHVAEIMSSPSEGYSPGSALEVSWCLLLLDVSHIEAAVKVSLDYEIKQDPEPKDSGGTIRVNAVIKNENDILTFT
TLTFVNEFLNQDFCLVDWCNFMKEAGISDQNIPVVIYHILYVIKITSSASNGHSPGCALQVSLYLFPHDETDIEEAVQVS
FDETTNFCLGPASKLVVKSLTRKIYDKINYTGERCTICLEEFNAGGILVALPCGHDFDDECAVKWFETNHFCPLCRYELP
REEDQ*

DNA
ATGTTTACAGTTCTACGCGTGGATTTCAGTCACAAAATCAAAGACGATCCTAAACCAGAAGAAGCGGGCATAATTATAGT
CAATGCAATGATCTACCGTGAAACTGATACCTTGACTTTGACGACGTCGTCGTCTGCCGACGAACTCATCAGCGATGATG
GCAACGAGTGTCAAATCAAAATGGATTTGATTAATATCTTGAAGGTAGCAGGGCTCAGCGACTACGATACTGCACATATG
ATGTATCACTTTATTCCCCATGTTGCTGAAATAATGTCTTCCCCAAGTGAAGGGTATTCTCCAGGGTCTGCTTTAGAAGT
GTCGTGGTGTCTTCTTCTTCTCGATGTGAGTCATATTGAGGCAGCGGTTAAAGTCTCGTTAGATTACGAAATCAAACAGG
ATCCTGAACCAAAAGATTCCGGCGGCACAATCAGAGTCAATGCAGTGATCAAGAATGAAAATGATATCTTGACTTTCACG
ACTTTGACGTTTGTCAACGAATTCCTCAACCAAGATTTTTGTCTCGTAGACTGGTGTAATTTCATGAAGGAAGCAGGGAT
CAGCGACCAAAATATTCCAGTTGTGATTTATCATATTTTATATGTTATTAAAATAACTTCTTCTGCAAGTAATGGGCATT
CTCCCGGGTGTGCTTTACAAGTGTCGTTGTATCTTTTTCCTCACGACGAGACTGATATCGAAGAAGCAGTTCAAGTCTCG
TTTGACGAGACCACTAATTTCTGTTTGGGACCCGCAAGCAAACTCGTGGTCAAGTCCTTAACCAGGAAAATATATGACAA
GATTAATTATACAGGCGAAAGATGCACAATTTGTTTGGAAGAGTTTAACGCTGGAGGAATACTTGTGGCTTTACCTTGTG
GACATGACTTTGACGATGAGTGTGCCGTAAAGTGGTTTGAGACCAATCACTTTTGTCCATTGTGTCGTTACGAGTTGCCA
CGCGAAGAAGATCAATGA