Details for Arabidopsis Locus AT3G13227

Position : Chr3 ( 5`- 4258006 .. 4258505 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13227

Protein [Map View]
MEGKEEEAKRRMMMKIKLKETEADVSQDDIKRQEAYNMSPRVRRGGGGGGGSVGMSKSSSVRQNCLCAPTTHPGSFRCRY
HRRNAGLGMSRGTSVPSNLSMLAGGDSNSPK*

DNA
ATGGAAGGGAAAGAGGAAGAAGCAAAGAGGAGGATGATGATGAAGATCAAACTTAAGGAGACAGAAGCAGACGTAAGCCA
AGACGACATTAAAAGACAAGAAGCTTACAACATGTCTCCACGCGTACGTCGTGGTGGTGGTGGTGGCGGTGGCTCGGTAG
GTATGAGCAAGTCATCGAGCGTGAGGCAAAACTGTTTATGCGCACCAACTACACACCCTGGCTCCTTCAGGTGCCGTTAC
CACCGTCGTAACGCTGGACTCGGGATGTCTCGTGGCACATCCGTTCCCTCTAACCTTTCCATGTTGGCTGGTGGAGACTC
TAATTCTCCCAAGTGA