Details for Arabidopsis Locus AT3G13226

Position : Chr3 ( 5`- 4264295 .. 4266362 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13226

Protein [Map View]
MLKLGFRLAIGIQHHRLFRIPWAKRHSVPRILCSEQRDYCSSGLTKYVPKKSRKITEDLTSQQFDVTRVDHSVLGFQVKG
NSKEARDGSFLDLQEENDTGSYTNVSCDDSDEGFMSLDKGIDASRLDHSVLGSKVKANIKETGEDTDFHLRDKNDADMYS
DVSCDDSNDESSNEVRSTGYKSTRQHKQAYDKIKLHLEAEQAKSSKEACKTTQDAEHMAIRYLGLRAYSAADLKKKLIGK
KYPIEVVDKVIDDFQIRGFVNDSLYAESFTRSRWSSLSWGPRRIKQALFKKGISNKDSETAIKLVFEKRQCNEGDEEAEL
NHGLSKEAVDQLYVQASKRWLQGRDLPTETRKTRVIRWLQYRGFNWGVVTQLLKRLESTHES*

DNA
ATGCTGAAACTAGGGTTTCGGTTAGCGATTGGCATTCAACATCATCGCCTCTTCCGTATTCCATGGGCGAAGAGACACTC
TGTACCTAGAATCTTGTGTTCTGAGCAGCGGGATTACTGTTCATCAGGTCTGACAAAGTATGTTCCTAAGAAGTCTCGGA
AGATTACTGAAGATTTGACATCTCAGCAATTTGATGTTACTAGAGTGGATCATAGTGTGTTGGGATTTCAAGTTAAGGGT
AACAGCAAAGAGGCTAGAGATGGCTCATTTTTGGATCTGCAAGAGGAAAATGATACTGGAAGTTACACGAATGTGTCTTG
TGATGACTCTGATGAAGGTTTTATGAGTTTGGACAAGGGTATAGATGCTAGTAGATTGGATCATAGTGTATTGGGGTCTA
AAGTGAAGGCTAACATCAAAGAGACTGGAGAGGATACTGATTTTCATCTGCGGGATAAAAATGATGCTGATATGTACTCT
GATGTTTCTTGTGATGACTCTAATGATGAAAGCAGCAACGAAGTTAGATCTACAGGCTATAAGTCGACGAGACAACACAA
ACAAGCTTATGATAAAATCAAACTACATTTGGAAGCTGAACAGGCCAAGAGTAGCAAAGAAGCCTGCAAAACCACGCAAG
ATGCAGAGCACATGGCTATTCGCTATCTCGGTTTAAGAGCATATTCAGCAGCTGACCTGAAGAAGAAGCTCATAGGAAAG
AAATATCCTATTGAAGTCGTTGACAAAGTGATCGATGATTTCCAGATTCGAGGTTTTGTCAATGATAGCTTGTACGCGGA
GTCATTCACTCGATCTAGATGGTCTTCCTTAAGTTGGGGACCAAGGCGGATCAAACAAGCATTGTTTAAGAAAGGCATAA
GCAACAAAGACTCAGAGACGGCCATAAAGCTGGTTTTTGAGAAACGCCAATGCAATGAAGGAGATGAAGAAGCAGAACTA
AACCACGGGCTGTCCAAGGAAGCAGTGGACCAGCTTTATGTCCAGGCATCAAAGCGGTGGCTTCAAGGTCGAGACTTGCC
TACAGAAACTCGTAAAACTAGAGTCATCCGGTGGCTTCAGTACCGGGGTTTCAACTGGGGTGTCGTTACCCAGCTTCTAA
AGAGGTTAGAGTCTACTCATGAGTCGTGA