Details for Arabidopsis Locus AT3G13225

Position : Chr3 ( 5`- 4258770 .. 4262911 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13225

Protein [Map View]
MGKRKERRYAAMNSTGRRVKLDLFAEPSGDLGGSDVRDGVEREQTELNELPNSPSSSGQKTENPLLLLGQYSDDEVEEDS
DKKADDTSADSFLANKNEQVDGLIQGGHKDTNIKSGAVTTTMQMADQQQTGENSSALDSRAEVETGYTTVSNSTTLDGLN
KQTVPSVQASGSVSLEHQAPTDVTSQWKMILHEESNQYYYWNTETGETSWELPTVLTQTTFAYGTGYNESGPMVTDASTL
ISSVEPSYFVPVQNSFTGTDYSTFPTVELDGRNKSEDLYVKSLGTDGHQVECRIDSVVSCQEDLSRPGNSDHVHTYFDAG
AATDLPSRLLSQIESLLEKLRSLKRSHGNFHSNEQITKYILEVEVRHSDVKALILDTSPLLSFWLHTEKQLKRLEDSVND
EIYQLAKSAVMDEPETNKSPPKEKLVADANTESESEDSERDGELAQSGKSLHSDESADGSGDGSPKHSPNHPAGQSDIIP
STEMLQKAGSPDVEDVDMDVDMEVEESVPVSSVQVIDASDGKMFSQTEPSNLHTDVPPPPGEEWIPPPPSESEDVPPPPP
DSYSEPIPPPPDNGHVASSLSSDSLGVPYTVPQSYMHQSADYATQYNLSYPESNYQYTNAVTLAPNTQFYGHVDGSQVSL
PQSTFYYETVPGTTEVVPAAASAGEAYYDFNGAAPLFPVISSGESSLHHSGVGSANHHIPNNSSTAAVPSSRSNDSTEVG
SSATASKSTDVTSGSSLLAKGQTKVKRTKKKTVAATSTLRSNKKVSSLVDKWKAAKEELNDSEEEEDDSEILDRKRKREI
EEWKSRQIASGEAKDNANFQPLGGDWREKVKRKRERAEKSQKKDPEKQQKPDLTKLSANLPSEWQAYWDESTKKVYYGNT
STSQTSWTRPTT*

DNA
ATGGGGAAGAGAAAAGAGCGTCGTTACGCCGCCATGAATAGCACCGGCCGTCGTGTCAAGCTTGATCTCTTTGCGGAACC
CTCTGGAGATTTGGGTGGCTCAGATGTGCGTGATGGAGTTGAGCGGGAACAAACAGAGCTTAATGAGCTACCCAATTCAC
CTTCTTCTTCAGGTCAGAAAACAGAAAATCCTTTGCTTTTACTTGGGCAGTATAGTGATGATGAGGTGGAAGAAGATTCG
GATAAGAAGGCAGATGATACCTCTGCAGATAGTTTCTTAGCCAATAAAAATGAGCAGGTTGATGGATTAATTCAAGGAGG
ACACAAAGATACGAATATCAAATCAGGTGCAGTCACCACCACTATGCAGATGGCTGATCAACAGCAGACAGGGGAGAATT
CTTCTGCTCTTGATTCTAGAGCTGAAGTAGAAACTGGTTATACCACAGTGAGTAACTCAACAACATTGGATGGACTAAAC
AAGCAGACAGTTCCCTCAGTTCAAGCATCTGGCAGTGTGTCTTTGGAGCACCAGGCTCCCACAGATGTTACGTCGCAGTG
GAAGATGATTCTGCATGAGGAGAGCAATCAGTATTATTACTGGAATACAGAAACTGGAGAAACTTCGTGGGAATTGCCTA
CAGTTTTGACTCAAACTACCTTTGCATATGGGACTGGGTACAATGAGTCTGGGCCCATGGTTACAGATGCTTCCACCTTG
ATTTCAAGTGTTGAACCAAGCTATTTCGTACCCGTGCAAAATAGTTTCACAGGAACTGACTATTCTACTTTTCCAACTGT
TGAGCTGGATGGGAGAAACAAAAGTGAAGATCTATATGTCAAAAGTTTAGGAACTGATGGTCATCAAGTTGAATGTCGGA
TAGACTCTGTTGTTAGTTGTCAGGAGGACCTTTCAAGGCCAGGAAATTCAGATCATGTGCATACTTATTTTGATGCAGGA
GCTGCTACTGACCTCCCATCTCGCTTGTTGAGTCAAATCGAAAGCTTACTGGAGAAGCTGAGGTCTCTGAAGAGGTCGCA
TGGGAACTTTCACAGCAATGAGCAGATAACAAAGTACATTCTGGAGGTTGAAGTCAGACATTCTGATGTAAAGGCGCTCA
TATTGGACACCTCACCTTTACTTTCTTTTTGGCTTCACACTGAGAAACAACTTAAGCGGCTGGAAGATAGTGTTAACGAT
GAGATTTACCAGCTTGCAAAATCTGCAGTAATGGATGAACCAGAAACTAACAAAAGCCCTCCCAAAGAAAAGTTGGTGGC
AGATGCTAATACAGAGAGTGAGTCCGAGGACAGTGAGAGAGATGGAGAGTTAGCTCAATCTGGAAAATCTCTTCATTCAG
ATGAATCAGCTGATGGGAGCGGCGATGGATCTCCTAAACACTCCCCAAATCATCCAGCTGGGCAGTCTGATATTATTCCT
TCAACTGAGATGCTTCAGAAGGCCGGCTCCCCAGATGTGGAAGATGTTGACATGGATGTGGATATGGAAGTTGAAGAATC
AGTTCCAGTGTCTTCTGTTCAAGTGATAGACGCTTCTGATGGTAAGATGTTCAGTCAAACAGAGCCATCCAACCTTCATA
CAGATGTTCCACCACCTCCGGGTGAGGAATGGATTCCACCACCGCCGTCTGAGAGTGAAGATGTTCCTCCACCGCCACCA
GACAGTTATAGCGAACCAATTCCTCCACCACCTGACAATGGCCATGTCGCTTCATCTTTGTCCAGTGACTCTCTCGGAGT
TCCCTATACCGTACCTCAATCATATATGCATCAATCTGCTGATTATGCGACACAATACAACTTATCCTATCCAGAGTCCA
ATTATCAATATACCAATGCTGTTACTCTAGCTCCTAATACTCAGTTCTATGGCCATGTGGATGGATCTCAAGTTTCTCTT
CCCCAATCCACATTTTATTATGAAACTGTTCCTGGTACAACTGAAGTTGTTCCTGCAGCAGCCAGTGCTGGTGAAGCTTA
TTACGATTTCAATGGTGCAGCTCCACTGTTTCCTGTCATTAGCTCGGGTGAGTCATCTCTACATCACAGTGGAGTTGGTT
CTGCTAATCACCACATCCCAAACAACTCTTCTACAGCTGCAGTGCCTAGTTCGAGATCCAATGACTCTACTGAGGTTGGA
TCTTCAGCAACTGCTTCTAAATCCACAGATGTTACAAGTGGATCGTCTCTATTAGCAAAAGGTCAAACTAAAGTGAAACG
GACAAAAAAGAAAACAGTAGCTGCTACATCTACATTGAGGTCAAATAAAAAGGTTTCCAGTTTGGTTGACAAGTGGAAAG
CTGCGAAAGAGGAGCTAAACGATAGCGAAGAAGAAGAAGATGATTCCGAAATCCTAGATAGAAAAAGAAAACGAGAAATC
GAAGAATGGAAATCTCGACAAATCGCAAGTGGAGAGGCTAAAGACAACGCAAATTTCCAACCCCTGGGTGGTGACTGGCG
TGAGAAAGTGAAACGGAAGAGAGAACGAGCTGAGAAGTCTCAGAAGAAAGACCCCGAAAAGCAGCAAAAACCTGATCTAA
CAAAACTCTCAGCAAATCTCCCGTCGGAATGGCAGGCATATTGGGACGAATCTACCAAAAAAGTTTACTATGGGAATACG
AGTACATCTCAAACCAGTTGGACACGACCCACTACCTGA