Details for Arabidopsis Locus AT3G13224

Position : Chr3 ( 5`- 4254743 .. 4257409 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13224

Protein [Map View]
MGSRSRNDNFQSGDGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIEDT
HVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSE
EVVDELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSYGSHPRGRSSNDSYASYGGPYGGFDGGYGHPPGPIRSHGGPAS
RYAGGYGYGRGSVGPEFGGGYNNYGGGSLGGYRNEPPLGYSSRFGPYGSGFGGEGYGRGGEGAYLGYPRGGGEGYGGYGG
PGYGGAYESGGPGGSYEGAGGPYGRGYSSSSRYHPYAR*

DNA
ATGGGTTCCAGATCTCGTAATGATAATTTCCAGTCCGGCGATGGCGCTAGTCCTGGGAAAATATTCATTGGAGGATTGCA
CAAAGACACGACTAATACTGTGTTCAATAAGCACTTTGGCAAGTACGGGGAGATTACAGATTCTGTCATTATGCGAGATC
GACATACTGGACAACCTAGGGGTTTCGGTTTCATCACCTTCGCTGACCCTTCTGTTGTTGACAAAGTTATCGAAGATACT
CATGTCATCAATGGCAAACAGGTTGAGATCAAAAGGACTATTCCGAAAGGTGCTGGTGGCAATCAGTCAAAGGACATCAA
AACAAAGAAGATTTTCGTTGGTGGTATACCCTCAACGGTTACAGAAGATGAACTTAAGGACTTCTTTGCCAAGTATGGGA
ACGTGGTGGAGCACCAGGTTATTCGAGACCATGAAACAAACAGGTCCAGAGGTTTTGGTTTTGTAATTTTTGATAGCGAA
GAAGTCGTAGATGAATTATTGTCCAAAGGAAACATGATCGATATGGCAGACACTCAGGTGGAGATCAAGAAAGCTGAACC
AAAGAAATCTCTAAACCGTTCACCTCCTTCTTACGGTAGTCACCCTAGAGGTCGTTCTTCTAACGATAGTTATGCAAGTT
ATGGTGGACCTTACGGAGGTTTTGATGGAGGGTATGGTCATCCTCCAGGTCCCATTAGGTCACATGGAGGTCCTGCTAGT
AGATATGCTGGGGGATATGGGTATGGTCGTGGCAGTGTAGGCCCTGAATTTGGAGGAGGTTATAATAATTATGGGGGTGG
TAGTTTAGGAGGTTACCGGAATGAACCACCCCTTGGCTATTCTAGTCGTTTTGGACCCTATGGGAGTGGGTTTGGTGGTG
AGGGATATGGCCGTGGAGGAGAAGGAGCCTATTTGGGATATCCTCGTGGAGGAGGGGAAGGCTATGGGGGATATGGTGGG
CCTGGTTACGGCGGTGCATATGAATCTGGTGGCCCAGGTGGCAGTTATGAAGGAGCAGGTGGTCCATATGGGAGGGGTTA
TAGTAGCAGTAGTCGATACCATCCGTATGCAAGGTAG