Details for Arabidopsis Locus AT3G13222

Position : Chr3 ( 5`- 4251014 .. 4254267 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13222

Protein [Map View]
MSRISGDGGSRVSIPADLLQTIQNIREVTGKQHSDEDIFSVFKECFSDPHETTQKLLYLDTFHEVRSKRERKKENLVPNT
QGRGRTGRKNFASSYTDASNGRSAAFKKQSGANHIIGGSGTASSAPNNARNDTKPSSIMAPNPISLPSGISNQKIQDAII
SPVDKVDTEEQPLSKATSSSKDVVEPDKSKESSVSVAVSDSVVENDTQYAVVETFQIPQQSERVIKSEVAASKCKNESLL
KSDVGERPHVTFPVHIQVAKMLENGLTFGSFDSNFVREASSDKFTIGCDDSNIESSHGTAASARKDISTFSQDKNHEISN
SAAQNELTLQPDQTVLPEEGSEGDKVKNEVLPITDTHQAAKCDAPPISYPDQYSLAAAQQAMHLYRQQYSLNYFPYGPYF
PPYYMPQPYIHQYLSPNGFQQQSYLPPGDDAPAPPGAELPLTHIKPGSDIGNSPPTTIPFSYTSYAFNHIPSAATINATH
KEEKKENMYTTGPLSLANLQASPMYNLSLQGQPIAFPTMQAGIRGLYQQTQPILAPLSISARTEPIGPSHVTNQQPQAAR
TNLGNNY*

DNA
ATGAGCAGGATCAGCGGCGATGGCGGCTCTAGGGTTTCTATTCCGGCTGATCTGCTTCAAACCATTCAAAACATCAGAGA
GGTTACCGGTAAACAACATTCCGACGAGGATATCTTCTCTGTCTTTAAGGAGTGTTTCAGTGATCCACATGAGACCACTC
AGAAGCTTCTCTATTTAGATACATTTCATGAGGTGAGAAGCAAACGGGAGAGAAAGAAAGAGAATTTAGTGCCAAATACA
CAAGGAAGGGGCCGGACTGGACGGAAGAACTTTGCTTCAAGTTACACAGATGCCAGTAATGGAAGAAGTGCAGCTTTTAA
AAAGCAGAGTGGAGCTAATCACATAATAGGAGGTTCTGGAACTGCTTCGTCTGCTCCTAACAATGCAAGAAACGACACAA
AACCTTCTTCCATAATGGCCCCGAACCCTATAAGTCTTCCAAGTGGAATCAGTAACCAGAAAATTCAAGATGCTATCATA
TCCCCTGTGGACAAGGTGGACACAGAGGAACAGCCTCTCTCCAAGGCTACTTCTTCTTCTAAGGATGTTGTTGAGCCGGA
TAAGTCTAAAGAAAGTAGTGTATCAGTGGCTGTATCAGATTCTGTTGTAGAAAACGATACTCAATATGCTGTAGTTGAAA
CTTTTCAGATCCCACAACAGTCCGAGCGAGTCATTAAGAGTGAGGTTGCAGCCAGTAAATGCAAGAATGAGTCGCTTCTC
AAGTCGGATGTTGGTGAACGGCCGCACGTAACATTTCCTGTCCACATTCAGGTTGCCAAAATGCTGGAAAATGGTCTGAC
ATTTGGGAGCTTCGATTCTAATTTTGTGAGAGAGGCATCTTCTGACAAGTTTACTATTGGGTGTGATGACTCCAATATTG
AGTCTTCTCATGGGACAGCCGCATCAGCTAGGAAAGATATATCAACTTTTTCTCAGGATAAGAATCATGAGATTTCAAAT
TCAGCAGCTCAGAACGAGTTAACATTGCAGCCAGATCAAACTGTTCTCCCTGAAGAAGGTTCAGAAGGAGATAAAGTAAA
GAACGAGGTTTTACCAATCACAGACACTCATCAGGCTGCAAAGTGTGATGCTCCACCTATCTCCTATCCTGATCAGTATT
CCTTAGCAGCCGCTCAACAGGCAATGCACCTTTATAGGCAACAATACTCTCTTAACTATTTCCCTTATGGTCCATATTTC
CCCCCTTATTATATGCCGCAACCATACATTCACCAGTACTTGAGCCCAAATGGGTTCCAACAACAGTCTTACTTACCACC
CGGAGATGATGCTCCAGCACCTCCAGGGGCTGAACTACCTCTCACTCACATCAAACCCGGAAGCGACATTGGAAACTCTC
CACCTACCACGATTCCATTCTCATATACTTCATACGCCTTCAACCACATCCCATCAGCAGCCACCATAAATGCTACTCAC
AAGGAAGAAAAGAAGGAAAACATGTACACAACTGGACCACTGAGTCTAGCCAATCTGCAGGCCAGTCCCATGTACAACTT
ATCCCTTCAAGGTCAGCCTATAGCTTTCCCAACCATGCAGGCTGGGATCCGTGGGTTATATCAACAAACACAGCCAATAC
TGGCGCCTCTATCTATATCTGCGAGGACTGAACCCATAGGACCATCGCACGTAACTAATCAGCAACCTCAAGCTGCACGA
ACAAATCTGGGAAACAACTACTAG