Details for Arabidopsis Locus AT3G13140

Position : Chr3 ( 5`- 4226654 .. 4227377 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13140

Protein [Map View]
MDYTVDMSCVMKVNRGCQLCRQKVSEVMHCVYGVYSVDFTGDDNSMKLKARVNPNVLLAVAERYGEHGKITNLRFDGEVM
TPRGGGGYYGQSGYYIPTTSRGNYAYPSLYQYPPPPHVYGGNYAHPPSNPPRHSEAPRQATNPHTTPPYYSLPAPPPRTL
HSYSYVEPQYRMSSSSGSGCVIM*

DNA
ATGGATTACACTGTCGATATGAGCTGTGTGATGAAAGTGAACAGAGGTTGCCAGCTTTGTCGGCAAAAAGTGTCAGAAGT
CATGCATTGTGTCTACGGAGTTTACTCTGTGGATTTCACCGGAGACGACAACTCAATGAAACTCAAGGCCAGAGTTAACC
CTAATGTATTGTTGGCTGTTGCTGAACGGTACGGTGAACATGGAAAGATCACTAATCTCCGTTTCGACGGAGAAGTTATG
ACTCCTCGCGGCGGCGGTGGTTATTACGGTCAATCAGGCTATTACATTCCTACCACCTCCCGTGGTAACTATGCATATCC
TTCGTTGTATCAATATCCTCCTCCGCCACATGTTTATGGCGGAAACTATGCTCATCCGCCGTCAAATCCCCCGCGGCACT
CGGAGGCACCACGGCAGGCAACTAACCCGCATACAACACCGCCGTATTATAGTCTACCGGCGCCACCACCAAGAACGTTG
CATAGTTACTCTTACGTAGAACCGCAGTATCGGATGTCGAGTTCGTCGGGTAGTGGATGCGTGATCATGTAA