Details for Arabidopsis Locus AT3G13120

Position : Chr3 ( 5`- 4219775 .. 4221666 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13120

Protein [Map View]
MAVSTVSSFLLPSFGIPSSSPSSTRLKVSLLPSSSTHGGLSSCVLTKPSVSLTKVFAVPDTLDPTPEILDEPASEVPSSS
SISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKKRIYCVLKSPHVHKDARFHFEIRTHQ
RMIDILYPTAQTIDSLMQLDLPAGVDVEVKL*

DNA
ATGGCGGTTTCTACTGTATCGTCGTTTCTATTGCCATCTTTCGGCATTCCAAGCTCTTCGCCTTCTTCTACCAGACTCAA
AGTCTCTCTGCTGCCTTCATCTTCTACCCATGGCGGCCTTAGTTCCTGCGTCCTTACGAAACCATCCGTCTCGCTTACGA
AGGTCTTCGCTGTTCCCGATACCCTAGATCCAACTCCAGAAATTCTCGATGAACCCGCCTCTGAGGTTCCGAGCTCTTCA
TCCATCAGTGTAGACGCGGATAAGATGGCGCCAAAGCAAAAGATTAGGATCAAGCTTAGATCATACTGGGTGCCTCTTAT
TGAGGACTCATGCAAGCAGATACTTGATGCTGCGAGAAACACCAATGCAAAGACGATGGGTCCTGTTCCATTGCCAACCA
AGAAGCGTATCTACTGTGTTCTCAAGTCTCCTCACGTTCACAAGGATGCTAGGTTCCATTTTGAAATCCGGACACACCAG
CGCATGATTGATATTCTCTACCCGACTGCTCAAACTATCGATTCTTTGATGCAACTTGATCTTCCTGCTGGTGTCGATGT
GGAAGTGAAGCTCTGA