Details for Arabidopsis Locus AT3G13070

Position : Chr3 ( 5`- 4191351 .. 4195112 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13070

Protein [Map View]
MMGMALELSVLGRSVIDSKTLNLKRYGQKSKLSGRFLPRAELHCPVALSSSKHSNLSFRFRRSCEFSYRSRFMLFSSSQC
HEGSQRKSDSGEKELESIKVLLKRGIVIGALVCGVFLYGCQKVLASAGVVEAGYEVFGQSVVLFKNALPKIYQVLTVLRE
QGLILAALLSLSAFFSMAETSITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIF
GEAGVSAATGLMTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLVLYPVGRIVTYLSMGILKILGLKGRSEPYVTE
DELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLVDVVAIDASASLVDFHSMWVTHQYSRVPVFEQRIDNIV
GIAYAMDLLDYVQKGDLLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGE
IFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSGFVCEAFGYIPKTGESVKVVLEKES
WEEDGEEEEGKQERQEPKEKNQIYRVEILAGNARKVSAVRFERVNDMDQVSEASDVKSMVPKFVRKWSSEEDDGNLSNEE
DQSENAVLDEHVLADNSKKQQ*

DNA
ATGATGGGTATGGCACTTGAATTATCTGTTCTGGGTCGATCTGTCATTGACTCTAAAACCTTAAATTTGAAGAGATATGG
TCAAAAATCGAAGCTTTCAGGAAGATTTCTGCCCAGAGCTGAGCTGCACTGCCCTGTGGCGTTGAGTTCTTCTAAACACT
CCAATTTGAGTTTTAGATTCCGACGAAGTTGTGAATTTAGCTACAGAAGTCGCTTTATGCTGTTTAGCTCCAGTCAATGT
CACGAGGGCAGTCAACGAAAGTCCGATTCTGGTGAAAAGGAGCTGGAGTCGATTAAGGTTTTGCTGAAACGTGGAATTGT
GATAGGAGCTCTAGTCTGTGGAGTTTTCTTGTATGGATGTCAGAAAGTGTTGGCATCGGCTGGTGTGGTCGAAGCAGGCT
ATGAGGTGTTTGGTCAGAGCGTAGTGTTGTTTAAGAATGCTTTGCCTAAAATTTACCAGGTTCTTACGGTTCTTAGAGAG
CAAGGTCTAATTTTGGCTGCGCTGCTCAGCCTCTCAGCATTCTTCTCTATGGCAGAGACGTCCATTACCACTCTGTGGCC
GTGGAAGGTGCGTGAGTTGGCTGAGAAAGAACCAGAGAATGGTGTATTCAGAATGCTCCGGAGTGATGTCACCAGATTCT
TGACGACTATACTTATTGGAACAACTGTTGTGAATATTGCGGCAACTGCACTGGTCACTGAAGCAGCAACAGCTATATTT
GGGGAAGCTGGTGTTAGTGCTGCCACTGGATTGATGACAGTGGCTATTTTACTCCTGACTGAGATTACTCCAAAAAGTGT
TGCTGTGCACAATGCTCAAGAAGTTGCAAGGATTGTGGTCAGGCCAGTGGCGTGGCTTTCCTTAGTATTATATCCTGTCG
GAAGAATTGTCACATATCTGTCAATGGGAATACTGAAAATTCTTGGTTTGAAAGGACGGAGTGAACCATATGTTACTGAA
GATGAGTTGAAACTGATGCTAAGAGGTGCAGAATTGAGTGGTGCCATTGAAGAAGAGGAGCAGGATATGATTGAAAATGT
GCTAGAGATTAAGGATACCCATGTTCGAGAGGTGATGACTCCCCTTGTTGATGTAGTCGCAATTGACGCCAGCGCCAGTC
TAGTTGATTTCCATAGTATGTGGGTGACCCATCAGTACTCAAGGGTGCCTGTTTTTGAGCAGCGTATTGATAATATAGTG
GGAATTGCATATGCTATGGATCTTCTAGATTATGTTCAGAAGGGTGATCTGTTAGAAAGTACTTCTGTGGGGGACATGGC
ACATAAACCTGCATATTTCGTCCCTGATTCAATGTCTGTTTGGAATCTTCTTAGAGAATTCCGAATAAGAAAGGTTCACA
TGGCAGTTGTCCTTAACGAATATGGTGGAACGATCGGAATAGTAACTCTTGAAGATGTGGTCGAAGAGATTGTTGGTGAA
ATTTTTGATGAAAACGATTCCAAAGAGGAGATTCAGAAGAAAACAGGATATATTGTCATGAGAGATGAGGGCATATATGA
TGTTGATGCTAATACATCAATTGACCAGCTATCTGAAGAACTGAATATGAAAATGCCAGAGGGCATTCAGTACGAGACAG
TCTCAGGCTTTGTGTGTGAGGCCTTTGGGTATATCCCAAAAACTGGAGAAAGTGTGAAGGTTGTTCTTGAAAAGGAAAGC
TGGGAAGAGGATGGTGAGGAGGAGGAAGGTAAACAGGAGAGGCAAGAGCCAAAGGAAAAGAACCAAATCTATAGAGTAGA
GATACTAGCAGGGAATGCAAGAAAAGTTAGTGCTGTCCGGTTTGAGAGAGTGAACGATATGGATCAAGTGTCGGAGGCAA
GTGATGTAAAAAGCATGGTTCCCAAATTTGTAAGGAAATGGAGCAGCGAAGAAGATGATGGGAACTTGTCCAACGAAGAA
GACCAATCCGAGAATGCTGTCTTAGATGAACATGTACTGGCTGATAATAGCAAGAAACAACAATGA