Details for Arabidopsis Locus AT3G13065

Position : Chr3 ( 5`- 4187371 .. 4191298 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13065

Protein [Map View]
MGPNLQRIVLVFIACFGIFTSVVLAKTDSQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITCKGSSVTEIKVSG
RGLSGSLGYQLGNLKSLTYLDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRNNLNGELSDM
FQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKGSINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLET
GGNKWSSGRAPSPPPGTRHIDRNSSGGGGGSSKALTLGVIIAVSSIGGLILFAGLIALISRRKNSNDSSHFFDDEKGTNR
SKPLFTPQSSQMLQFDNMEEFKNQKTVDSNTSLETKPSVKRTSSVSFKNSPTFHLIPSTQVAATPDRSSTSQDSPDTRGV
KAFSLADLQNTASCFSPNRLLGEGTIGRVYKAKFQDGRKFAVKEIDSSLLGKGNPEEFSHIVSSISSIHHKNMAELVGYC
SEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLS
DYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDE
MVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEALKRLV*

DNA
ATGGGACCAAATCTGCAGCGGATCGTACTTGTCTTCATTGCATGTTTCGGAATCTTCACCTCCGTTGTTCTTGCAAAAAC
CGATAGCCAAGACGTATCTGCTCTTAATGACGCTTATAAGAGCATGAACTCTCCATCAAAACTCAAAGGCTGGTCTTCAA
GCGGAGGCGATCCTTGTGGCGATTCGTGGGATGGCATTACTTGCAAAGGCTCTTCTGTTACTGAAATAAAAGTATCTGGA
CGTGGACTCAGTGGATCTTTAGGTTACCAGCTTGGAAACTTGAAATCGCTCACTTACCTTGATGTAAGCAAGAACAATCT
TAACGGAAACTTACCCTACCAGCTTCCTGACAAGCTTACTTATCTAGATGGCTCTGAGAATGACTTCAACGGTAATGTGC
CATATTCGGTGTCTCTCATGAACGACCTCAGTTACCTAAACCTTGGCCGTAACAACCTCAATGGTGAACTCAGTGACATG
TTTCAAAAGCTTCCAAAACTTGAAACAATTGATCTTTCTTCCAATCAACTCACGGGAAAACTACCGCAGAGTTTTGCCAA
TCTAACAGGTCTTAAAACACTGCATTTGCAAGAAAACCAATTCAAAGGCTCTATAAATGCTCTCAGGGACCTCCCTCAGA
TTGATGATGTAAACGTAGCAAACAATCAATTTACTGGTTGGATCCCAAACGAGTTGAAGAATATTGGAAACCTTGAAACT
GGAGGAAACAAGTGGTCAAGCGGTAGAGCTCCTTCACCACCTCCGGGAACCCGTCACATAGACAGAAACTCATCAGGAGG
CGGTGGAGGAAGCAGCAAGGCTCTGACACTAGGAGTTATAATAGCGGTGTCTTCTATAGGTGGACTCATTTTATTTGCAG
GGTTGATTGCATTGATTTCTCGAAGAAAGAACTCTAATGATTCTTCTCACTTTTTCGACGACGAGAAAGGAACCAACCGA
AGCAAGCCACTCTTCACACCACAATCCTCTCAGATGCTTCAATTCGATAATATGGAAGAATTCAAAAACCAGAAGACAGT
TGATTCTAATACTTCACTTGAAACAAAGCCTTCTGTTAAAAGAACTTCTTCTGTCAGTTTCAAGAACTCTCCTACTTTTC
ATCTCATACCTTCTACCCAAGTGGCTGCTACCCCTGACCGTTCCTCCACCTCCCAAGACTCTCCTGATACACGCGGTGTG
AAAGCGTTTTCACTAGCGGATTTGCAGAATACCGCGTCTTGTTTCTCGCCGAATCGCCTTCTTGGTGAAGGAACCATTGG
ACGTGTTTATAAAGCTAAATTTCAGGATGGAAGGAAATTTGCAGTCAAAGAGATTGATTCTTCTCTGTTAGGAAAAGGCA
ATCCGGAAGAGTTTTCACACATAGTGTCGAGTATCTCGAGTATTCACCACAAGAATATGGCAGAACTCGTGGGTTATTGT
TCAGAACAAGGAAGAAATATGCTTGTTTATGAGTATTTCACAAGTGGATCACTTCACAGATTTCTTCACCTGTCTGATGA
TTTCAGCAAACCATTGACGTGGAACACCAGAATCCGAATCGCTCTCGGAACTGCTAAAGCTATAGAGTACCTTCATGAAA
CATGTTCGCCTCCGCTAGTTCACAAGAACATCAAGTCATCAAACATTTTACTTGATAATGAGCTAAATCCCCGCCTCTCA
GACTATGGCTTGGCAAACTTTCACCACCGCACAAGTCAGAATCTTGGAGTTGGATACAATGCCCCAGAATGCACAGATCC
CTCCGCTTACACACAAAAGAGCGACGTGTACAGCTTTGGTGTGGTGATGCTTGAGCTGCTAACTGGTCGAAAGCCTTATG
ACAGTGGGAGGCCAAAAGCAGAACAGTCTTTAGTTCGTTGGGCAAAGCCGCAGCTTAAAGACATGGATACTCTGGATGAA
ATGGTGGATCCCGCGTTGTGCGGACTCTACGCTCCAGAATCTGTATCATCATTCGCGGATATAGTTTCCATCTGCGTAAT
GACGGAGCCTGGACTTAGGCCTCCAGTGTCAAATGTGGTGGAGGCATTGAAGAGGCTAGTGTAG