Details for Arabidopsis Locus AT3G13050

Position : Chr3 ( 5`- 4176511 .. 4179066 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13050

Protein [Map View]
MADGNTRFTVDEALVAMGFGKFQIYVLAYAGMGWVAEAMEMMLLSFVGPAVQSLWNLSARQESLITSVVFAGMLIGAYSW
GIVSDKHGRRKGFIITAVVTFVAGFLSAFSPNYMWLIILRCLVGLGLGGGPVLASWYLEFIPAPSRGTWMVVFSAFWTVG
TIFEASLAWLVMPRLGWRWLLAFSSVPSSLLLLFYRWTSESPRYLILQGRKAEALAILEKIARMNKTQLPPGVLSSELET
ELEENKNIPTENTHLLKAGESGEAVAVSKIVLKADKEPGFSLLALLSPTLMKRTLLLWVVFFGNAFAYYGVVLLTTELNN
SHNRCYPTEKQLRNSNDVNYRDVFIASFAEFPGLLISAAMVDRLGRKASMASMLFTCCIFLLPLLSHQSPFITTVLLFGG
RICISAAFTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGILCPLVAVGLVHGCHQTIAVLLFEVVILVSGICVCLFPFET
SGRDLTDSISASKEPPSASV*

DNA
ATGGCAGATGGGAACACAAGATTCACGGTGGATGAAGCTCTTGTGGCGATGGGATTTGGCAAGTTCCAAATTTACGTCCT
TGCTTACGCTGGAATGGGTTGGGTTGCAGAGGCCATGGAGATGATGCTTCTCTCTTTCGTTGGACCTGCTGTTCAATCTC
TCTGGAATCTCTCTGCACGCCAGGAAAGCTTAATAACTAGCGTCGTTTTTGCTGGCATGCTCATTGGTGCTTACTCTTGG
GGCATTGTTTCTGATAAACATGGCCGCAGGAAAGGGTTTATCATAACTGCGGTGGTGACTTTTGTAGCTGGTTTCTTGAG
CGCATTTTCACCTAACTACATGTGGTTGATCATTCTTCGCTGTTTGGTTGGTCTTGGGTTGGGAGGAGGTCCTGTTCTTG
CTTCTTGGTATCTTGAATTCATACCTGCACCAAGCCGAGGGACTTGGATGGTTGTTTTCTCAGCTTTCTGGACCGTTGGA
ACCATATTTGAGGCTTCCCTTGCTTGGTTAGTCATGCCAAGATTGGGTTGGAGGTGGTTACTTGCATTCTCTTCGGTACC
TTCTTCGTTACTTCTTCTGTTCTATAGGTGGACATCTGAGTCTCCTCGGTACTTAATTCTACAAGGCCGGAAAGCCGAAG
CTCTTGCCATATTAGAGAAGATTGCGAGGATGAACAAAACCCAACTACCTCCGGGTGTTCTCAGTTCAGAGTTGGAGACC
GAGCTGGAAGAGAATAAAAACATTCCAACAGAAAATACTCATCTTCTCAAGGCTGGAGAAAGTGGAGAAGCGGTTGCTGT
GTCTAAGATTGTACTAAAAGCTGATAAGGAACCAGGTTTCTCATTACTAGCTCTTCTATCTCCAACGCTAATGAAGCGGA
CTTTGCTACTATGGGTTGTGTTCTTTGGAAATGCGTTTGCTTACTATGGCGTTGTCCTTCTCACCACCGAGCTGAACAAT
TCCCATAACCGCTGCTATCCAACCGAGAAACAGTTGCGAAATTCAAACGATGTTAACTACAGAGACGTTTTCATTGCCAG
TTTCGCAGAGTTTCCAGGTCTACTGATATCAGCAGCAATGGTGGATAGACTTGGACGAAAAGCTTCAATGGCATCAATGT
TGTTCACATGTTGCATTTTCCTTCTCCCTCTGTTATCCCATCAGTCTCCATTCATAACCACCGTTCTTCTCTTCGGCGGC
CGTATCTGCATCTCGGCAGCTTTCACAGTGGTTTACATATATGCTCCGGAGATATATCCAACGGCAGTGAGAACAACCGG
AGTAGGAGTAGGGAGCTCGGTAGGAAGAATTGGAGGAATCTTATGTCCACTCGTAGCCGTTGGATTAGTTCACGGATGCC
ATCAGACGATCGCTGTTCTTCTGTTTGAGGTTGTGATTCTTGTGTCAGGAATTTGCGTTTGTCTCTTCCCTTTCGAGACA
AGTGGTCGTGACCTGACAGATAGTATCTCTGCGTCCAAAGAACCACCTTCAGCCTCCGTATAG