Details for Arabidopsis Locus AT3G13010

Position : Chr3 ( 5`- 4162931 .. 4164733 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13010

Protein [Map View]
MASIVVNVHDYGTWVEDGARVQCTFCDKRMNDFNRLKYHLGNVCKDVTPCSQVPLPIREAFFKMVMEQRYPDRKRGRSNK
GFTASETAAEAEKLAQMDVAQFFYEHGVDFSAVDSTSFKKMMMIKTVGGEGGGQMIPDSRDLNGWMFQEALKKVQDRVKE
IKASWEITGCSILFDAWIGPKGRDLVTFVADCPAGAVYLKSADVSDIKTDVTALTSLVNGIVEEVGVRNVTQIIACSTSG
WVGDLGKQLAGQVFWSVSLSYCLKLMLVEIGKMYSFEDIFEKVKLLLDLINNNPSFLYVFRENSHKVDVSSECEFVMPYL
TLEHIYWVRRAGLFASPEWKKEQGIAISSFVNDSTFWESLDKIVGSTSSLVHGWLWFSRGSKHVAYAYHFIESIKKNVAW
TFKYERQFYEPTWNVIDDVWHNNHNPLHAAGYFLNPMAYYSDDFHTYQHVYTGLAFSLVHLVKEPHLQVKIGTQLDVYRY
GRGCFMKASQAGQLNGVSPVNWWTQKANQYPELQNLAVKILSQTSEGASRYKLKRSVAEKLLLTEGMSHCERKHLEELAV
VHYNLQLQSCKA*

DNA
ATGGCTAGCATCGTGGTGAATGTTCATGACTATGGAACTTGGGTGGAGGATGGAGCTCGGGTTCAGTGCACATTTTGCGA
CAAGCGAATGAATGACTTTAATCGTCTCAAGTATCATTTGGGAAATGTCTGTAAGGACGTAACCCCATGCTCACAAGTTC
CATTACCTATTAGAGAGGCATTTTTTAAGATGGTTATGGAGCAGAGATATCCTGATCGTAAACGTGGAAGATCCAACAAA
GGTTTTACTGCTTCTGAGACAGCTGCGGAAGCTGAAAAACTAGCCCAAATGGACGTTGCTCAGTTCTTTTATGAACACGG
TGTCGACTTCTCTGCTGTGGATTCGACAAGTTTCAAAAAGATGATGATGATCAAGACAGTAGGAGGAGAAGGTGGTGGTC
AGATGATCCCTGACTCTCGTGATTTAAACGGCTGGATGTTTCAAGAAGCTTTGAAGAAGGTGCAAGATCGTGTGAAGGAG
ATTAAAGCTTCGTGGGAGATCACTGGGTGCAGCATCCTCTTTGATGCTTGGATTGGCCCGAAAGGACGTGATCTGGTTAC
TTTCGTTGCAGACTGTCCAGCTGGGGCAGTGTATCTGAAATCCGCTGATGTTTCTGATATAAAAACCGATGTCACTGCCT
TAACTTCGCTGGTAAATGGGATCGTTGAGGAAGTTGGAGTGCGTAACGTGACTCAGATTATTGCATGTTCCACCTCTGGT
TGGGTTGGTGATTTAGGCAAGCAACTTGCTGGTCAAGTTTTCTGGTCTGTGAGTCTTTCCTATTGCTTAAAGCTTATGCT
GGTGGAGATTGGGAAAATGTATTCCTTTGAAGACATATTTGAAAAGGTCAAGCTCCTTCTAGATCTGATCAATAACAACC
CCTCCTTTCTATATGTCTTCAGAGAGAATAGTCATAAAGTCGACGTATCCTCAGAGTGTGAGTTTGTTATGCCGTATCTA
ACTCTAGAGCACATTTATTGGGTGAGGAGGGCAGGGTTGTTTGCTAGTCCTGAATGGAAGAAAGAACAAGGCATAGCAAT
ATCCAGTTTTGTGAATGATTCCACATTTTGGGAATCTCTTGACAAAATTGTGGGAAGTACATCTTCTCTGGTTCATGGAT
GGTTATGGTTTTCAAGAGGCAGCAAGCATGTTGCATATGCCTATCATTTTATAGAGAGCATCAAGAAGAACGTCGCGTGG
ACTTTCAAGTACGAGAGACAGTTTTACGAGCCGACATGGAATGTGATAGATGACGTGTGGCACAACAACCACAATCCTCT
TCATGCTGCTGGTTATTTTCTGAATCCGATGGCTTACTACTCCGATGATTTCCATACTTATCAACATGTATACACCGGTC
TTGCCTTCTCTCTGGTTCACTTGGTAAAAGAACCTCACCTTCAAGTGAAGATTGGTACACAGCTTGATGTGTATAGATAC
GGTAGAGGTTGCTTTATGAAAGCCAGTCAAGCTGGTCAGCTCAATGGAGTCTCTCCAGTTAATTGGTGGACTCAAAAGGC
GAACCAGTATCCTGAACTGCAGAATCTCGCTGTTAAGATTCTGAGCCAAACAAGTGAAGGTGCTTCAAGGTACAAGCTGA
AGAGAAGCGTAGCAGAGAAGCTGTTGCTCACTGAAGGAATGAGCCACTGTGAACGAAAGCATCTGGAAGAGTTGGCTGTT
GTACATTACAATCTCCAACTACAAAGCTGCAAAGCCTAA