Details for Arabidopsis Locus AT3G13000

Position : Chr3 ( 5`- 4157967 .. 4162065 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G13000

Protein [Map View]
MYDSQVLKSKYNPFLRRSHSGKKFQGTVTMSEGRETCEESTSGESFPYRFQLEEDVKRLQLQLQQEIDLHTFLESVMEKD
PWELSYSSSVPHPAQELLSNIVTLETAVTKLEQEMMSLNFQLSQERNERRLAEYQLTHSASPLNSSSSLRYLNQSDSELH
QSAEDSPSQDQIVHYQESSSESSPAESTVEQTLDPSNDFLEKRLMRKTNARKLPRGMPPKYLWDQPNLLSEEMVRCMKNI
FMSLADPTATSKASSNESHLSPVSPRGHLSSSASWWPSTERSMISSWVQSPQIDIQNNANVLATGDVFDPYRVRGKLSWA
EIGNYSLASEVSWMSVGKKQLEYASGALKKFRTLVEQLARVNPIHLSCNEKLAFWINLYNALIMHAYLAYGVPKSDLKLF
SLMQKAAYTVGGHSYTAATMEYVILKMKPPMHRPQIALLLAIHKMKVSEEQRRASIDTHEPLLGFALSCGMYSSPAVRIY
SAKGVKEEMLEAQRDFIQASVGLSSKGKLLLPKMLHCYAKSLVEDSNLGVWISRYLPPHQAAFVEQCISQRRQSLLASRN
CGILPFDSRFRYLFLPDDNTSL*

DNA
ATGTATGACTCTCAAGTTTTGAAATCTAAATACAACCCATTTCTCAGACGTTCGCATTCTGGAAAGAAATTTCAGGGCAC
AGTTACCATGTCAGAGGGCAGAGAAACTTGCGAAGAATCTACGAGTGGTGAATCTTTTCCATATAGATTTCAACTTGAAG
AGGATGTAAAAAGATTGCAACTGCAACTCCAACAAGAAATAGATTTGCATACATTTCTAGAGAGTGTCATGGAGAAAGAT
CCTTGGGAGCTATCTTATTCTTCTAGTGTTCCACATCCTGCTCAGGAACTTCTCTCCAATATAGTGACGCTAGAGACTGC
AGTCACTAAGCTCGAGCAAGAAATGATGTCACTGAATTTCCAACTTAGCCAAGAGAGAAACGAGAGGAGACTCGCGGAAT
ACCAGTTGACACATTCGGCTTCTCCACTAAATTCTTCTTCTTCCCTAAGATATTTGAATCAGTCAGATTCTGAATTACAT
CAATCAGCAGAAGACAGTCCATCTCAAGACCAAATAGTCCATTACCAAGAATCTTCATCTGAATCATCTCCAGCAGAGTC
AACTGTTGAGCAAACACTGGACCCAAGTAATGACTTTCTTGAAAAGAGGCTAATGAGAAAGACAAATGCGAGGAAGCTAC
CTCGAGGAATGCCACCTAAGTACCTGTGGGATCAACCTAATCTATTATCTGAAGAAATGGTGAGATGTATGAAGAATATC
TTCATGTCTCTTGCTGATCCAACAGCAACTTCAAAAGCTTCCTCAAACGAAAGCCACCTCTCACCAGTATCACCTCGCGG
GCATCTATCAAGCTCAGCATCCTGGTGGCCTTCAACAGAACGGTCAATGATCTCCTCATGGGTGCAAAGCCCACAAATAG
ATATCCAAAATAACGCCAATGTTTTGGCCACAGGAGATGTCTTTGATCCTTATAGAGTTCGTGGGAAGTTAAGCTGGGCG
GAGATTGGGAACTACAGTTTGGCATCCGAGGTTTCTTGGATGTCTGTAGGGAAGAAACAGCTGGAGTATGCTTCCGGGGC
ATTGAAGAAGTTCAGGACACTGGTTGAGCAATTGGCTAGAGTAAATCCTATTCATTTAAGCTGCAACGAGAAGCTTGCTT
TCTGGATTAACCTTTATAACGCGTTGATAATGCATGCTTATTTGGCTTATGGCGTCCCAAAAAGCGACCTGAAGCTTTTC
TCGTTGATGCAAAAGGCAGCCTATACAGTTGGAGGGCACTCATATACTGCGGCGACAATGGAATATGTGATACTGAAGAT
GAAACCGCCTATGCACAGGCCACAAATTGCTTTGCTTCTTGCCATCCACAAGATGAAAGTATCAGAAGAACAGCGCAGGG
CAAGCATTGATACACATGAACCTCTTCTCGGCTTTGCTCTAAGCTGTGGAATGTACTCTTCACCTGCGGTGAGGATCTAC
TCTGCGAAAGGAGTGAAGGAAGAGATGCTAGAAGCACAAAGGGACTTCATACAAGCATCGGTAGGGCTGAGCAGCAAAGG
GAAGCTCTTACTACCCAAAATGCTCCATTGTTATGCCAAGAGTTTGGTGGAGGATTCGAACTTGGGGGTCTGGATATCAA
GGTACCTTCCTCCACATCAAGCTGCTTTTGTGGAGCAATGCATCTCTCAGAGAAGACAAAGCCTTCTCGCTTCACGGAAC
TGCGGAATACTCCCCTTCGATTCTCGTTTCAGATACCTGTTTCTCCCCGACGACAACACCTCGTTGTAA