Details for Arabidopsis Locus AT3G12990

Position : Chr3 ( 5`- 4156186 .. 4157964 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12990

Protein [Map View]
MEGRLNNMWRLTVNESKFVESALQSELRVDGRGLYDYRKLTIKFGKEYGSSQVQLGQTHVMAFVTAQLVQPYKDRPSEGS
FSIFTEFSPMADPSFEPGHPGESAVELGRIIDRALRESRAVDTESLCVLAGKLVWSVRIDLHILDNGGNLVDAANVAALA
ALMTFRRPDCTVGGDNSQDVIIHPPEEREPLPLIIHHLPIAFTFGFFNKGSILVMDPTYVEEAVMCGRMTVTVNANGDIC
AIQKPGEEGVNQSVILHCLRLASSRASATTKIIRDAVEAYNRERSSQKVKRHHTLAKSEVLGPIVVV*

DNA
ATGGAGGGGAGGTTGAATAATATGTGGAGGTTGACTGTGAATGAGAGCAAATTCGTTGAATCTGCGTTGCAATCTGAGCT
CAGAGTCGATGGTCGTGGCCTTTATGATTACCGCAAGCTTACTATTAAGTTTGGCAAGGAATATGGCAGCTCACAAGTTC
AACTGGGTCAGACTCATGTAATGGCTTTTGTGACTGCTCAGCTAGTACAACCTTACAAAGACAGACCTAGTGAAGGCTCC
TTCTCTATCTTCACCGAGTTTTCTCCAATGGCTGATCCATCGTTTGAGCCAGGGCATCCTGGTGAATCTGCTGTTGAGCT
TGGCCGTATTATAGACCGTGCTCTACGAGAAAGCCGTGCAGTAGATACAGAGTCGCTTTGTGTTCTAGCCGGAAAGCTGG
TTTGGTCTGTTCGCATTGATCTTCACATTTTGGACAATGGAGGGAACTTGGTTGATGCTGCTAATGTTGCTGCCTTAGCC
GCACTCATGACTTTCAGGAGACCTGATTGCACTGTAGGAGGGGACAACAGTCAAGACGTGATCATACATCCACCCGAAGA
AAGGGAACCACTTCCTTTGATAATACATCATCTCCCAATAGCCTTCACGTTTGGATTTTTTAATAAAGGCAGTATCTTGG
TGATGGACCCAACTTACGTTGAAGAAGCTGTTATGTGTGGGAGAATGACTGTGACAGTCAATGCCAATGGCGATATATGC
GCAATCCAAAAACCAGGAGAAGAAGGCGTGAACCAGAGTGTAATCCTTCATTGCCTGCGTCTTGCTTCTTCAAGAGCTTC
TGCAACAACAAAGATAATTAGAGATGCAGTTGAAGCATACAACCGTGAGAGGAGCTCACAGAAGGTGAAGCGGCATCATA
CTTTGGCTAAGTCTGAAGTTTTGGGACCTATTGTAGTTGTGTAG